Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8T884

Protein Details
Accession A0A1V8T884   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-42NGSGRPVRPRPPKPPQPRDGDYBasic
NLS Segment(s)
PositionSequence
27-33VRPRPPK
70-84REPPRPKPRPPPWPR
Subcellular Location(s) nucl 10, cyto_nucl 8.833, mito 8, cyto 5.5, cyto_pero 4.666
Family & Domain DBs
Amino Acid Sequences MASTYRNTPSRVDPQPRDPGNGSGRPVRPRPPKPPQPRDGDYRYPSMNTFDFAPYSIVMAAGQPSTRMGREPPRPKPRPPPWPRDPGNGRFSREAIGMDFDERRTRRMAEPQPKDPGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.68
3 0.67
4 0.65
5 0.58
6 0.56
7 0.53
8 0.51
9 0.46
10 0.44
11 0.47
12 0.48
13 0.49
14 0.52
15 0.55
16 0.59
17 0.66
18 0.69
19 0.74
20 0.79
21 0.85
22 0.83
23 0.81
24 0.77
25 0.75
26 0.71
27 0.68
28 0.6
29 0.54
30 0.47
31 0.4
32 0.36
33 0.32
34 0.25
35 0.18
36 0.17
37 0.14
38 0.13
39 0.12
40 0.12
41 0.09
42 0.09
43 0.08
44 0.06
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.05
52 0.06
53 0.07
54 0.07
55 0.1
56 0.18
57 0.28
58 0.37
59 0.46
60 0.56
61 0.61
62 0.66
63 0.74
64 0.76
65 0.77
66 0.77
67 0.77
68 0.73
69 0.79
70 0.76
71 0.75
72 0.73
73 0.69
74 0.71
75 0.66
76 0.62
77 0.54
78 0.51
79 0.43
80 0.37
81 0.3
82 0.22
83 0.2
84 0.17
85 0.17
86 0.17
87 0.17
88 0.25
89 0.24
90 0.26
91 0.26
92 0.28
93 0.32
94 0.41
95 0.5
96 0.53
97 0.6
98 0.66