Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NY68

Protein Details
Accession G9NY68    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
70-89CPKQHRLSGKKKKQANLPKPBasic
NLS Segment(s)
PositionSequence
79-81KKK
Subcellular Location(s) mito 16.5, cyto_mito 10.333, nucl 6.5, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MSQTRISSGVLKSAAKAVSGSHYSKQVLLATGEGLNSNARIQKVGNPQNRFILCNYGMMLTYSTTAAATCPKQHRLSGKKKKQANLPKPLLLITPVFAAKKYPPVCSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.19
4 0.15
5 0.17
6 0.21
7 0.23
8 0.21
9 0.25
10 0.25
11 0.25
12 0.26
13 0.22
14 0.19
15 0.17
16 0.15
17 0.13
18 0.12
19 0.12
20 0.1
21 0.09
22 0.08
23 0.08
24 0.09
25 0.1
26 0.09
27 0.1
28 0.1
29 0.17
30 0.26
31 0.35
32 0.41
33 0.41
34 0.43
35 0.48
36 0.48
37 0.43
38 0.33
39 0.3
40 0.23
41 0.2
42 0.19
43 0.14
44 0.13
45 0.12
46 0.12
47 0.07
48 0.07
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.08
55 0.09
56 0.15
57 0.19
58 0.25
59 0.27
60 0.31
61 0.4
62 0.47
63 0.57
64 0.62
65 0.68
66 0.71
67 0.76
68 0.79
69 0.8
70 0.81
71 0.8
72 0.79
73 0.75
74 0.7
75 0.65
76 0.59
77 0.5
78 0.4
79 0.31
80 0.21
81 0.18
82 0.17
83 0.16
84 0.15
85 0.18
86 0.18
87 0.27
88 0.28