Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8ST89

Protein Details
Accession A0A1V8ST89   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MGSSAKKKREKKSDFKKTKLKVGKARPKNTNATDHydrophilic
NLS Segment(s)
PositionSequence
5-28AKKKREKKSDFKKTKLKVGKARPK
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024679  Ipi1_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0097344  C:Rix1 complex  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF12333  Ipi1_N  
Amino Acid Sequences MGSSAKKKREKKSDFKKTKLKVGKARPKNTNATDTSFAAKSIVLKQQSLSESGRDPPTIFNHNLSLLASKADTQRRDALSWLTNAIPTMNATSLPQPPSAILSKAQPLILDGTASVRSQLLKLLRVLPSDQLGPIDQVLLYTRAGMSHLSTDIKLSSLDVLDWLIEAQPESTVSCAGGWVKTLETFEKLLSWTGAKGTTGSLTGDGKWSATKPTVSLGSSKLLVHQLNSLTTFLNAGLVRPVRNEDLLAIQAAQCWPLWHFEAHLMPTKSNPYGYLNLFGKPRDTKSEMYEDPEERQEAFVTSGMYRAFSQDVTEARKEGGEVGRAAAGVAKALQLVVDVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.92
4 0.88
5 0.88
6 0.87
7 0.85
8 0.84
9 0.85
10 0.86
11 0.86
12 0.89
13 0.87
14 0.85
15 0.84
16 0.8
17 0.77
18 0.7
19 0.65
20 0.59
21 0.52
22 0.49
23 0.39
24 0.33
25 0.26
26 0.22
27 0.19
28 0.21
29 0.26
30 0.24
31 0.25
32 0.25
33 0.31
34 0.31
35 0.33
36 0.29
37 0.25
38 0.25
39 0.29
40 0.31
41 0.26
42 0.26
43 0.25
44 0.29
45 0.32
46 0.32
47 0.29
48 0.28
49 0.28
50 0.28
51 0.24
52 0.2
53 0.15
54 0.14
55 0.12
56 0.12
57 0.18
58 0.24
59 0.25
60 0.27
61 0.34
62 0.36
63 0.36
64 0.35
65 0.34
66 0.3
67 0.3
68 0.28
69 0.21
70 0.19
71 0.18
72 0.16
73 0.12
74 0.1
75 0.1
76 0.09
77 0.08
78 0.09
79 0.12
80 0.16
81 0.18
82 0.18
83 0.16
84 0.16
85 0.19
86 0.2
87 0.18
88 0.15
89 0.15
90 0.18
91 0.19
92 0.19
93 0.16
94 0.15
95 0.16
96 0.14
97 0.12
98 0.09
99 0.09
100 0.1
101 0.1
102 0.1
103 0.08
104 0.08
105 0.08
106 0.12
107 0.13
108 0.14
109 0.15
110 0.19
111 0.2
112 0.21
113 0.22
114 0.19
115 0.19
116 0.17
117 0.16
118 0.12
119 0.11
120 0.1
121 0.09
122 0.08
123 0.06
124 0.06
125 0.07
126 0.07
127 0.07
128 0.06
129 0.06
130 0.06
131 0.07
132 0.07
133 0.06
134 0.06
135 0.08
136 0.08
137 0.08
138 0.09
139 0.08
140 0.08
141 0.08
142 0.07
143 0.06
144 0.06
145 0.05
146 0.05
147 0.05
148 0.04
149 0.04
150 0.04
151 0.04
152 0.03
153 0.04
154 0.03
155 0.03
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.05
164 0.05
165 0.05
166 0.06
167 0.06
168 0.07
169 0.08
170 0.08
171 0.09
172 0.1
173 0.09
174 0.1
175 0.1
176 0.09
177 0.09
178 0.09
179 0.07
180 0.08
181 0.08
182 0.07
183 0.07
184 0.07
185 0.07
186 0.07
187 0.07
188 0.08
189 0.08
190 0.08
191 0.09
192 0.09
193 0.09
194 0.09
195 0.1
196 0.1
197 0.12
198 0.12
199 0.11
200 0.13
201 0.15
202 0.15
203 0.16
204 0.16
205 0.16
206 0.17
207 0.16
208 0.16
209 0.18
210 0.17
211 0.16
212 0.17
213 0.17
214 0.16
215 0.18
216 0.16
217 0.12
218 0.12
219 0.12
220 0.09
221 0.11
222 0.1
223 0.09
224 0.13
225 0.14
226 0.14
227 0.15
228 0.18
229 0.15
230 0.16
231 0.16
232 0.13
233 0.14
234 0.14
235 0.13
236 0.11
237 0.09
238 0.1
239 0.1
240 0.1
241 0.08
242 0.08
243 0.08
244 0.11
245 0.13
246 0.11
247 0.12
248 0.16
249 0.18
250 0.2
251 0.27
252 0.26
253 0.25
254 0.27
255 0.3
256 0.27
257 0.25
258 0.25
259 0.21
260 0.25
261 0.26
262 0.31
263 0.28
264 0.3
265 0.32
266 0.3
267 0.31
268 0.31
269 0.33
270 0.33
271 0.36
272 0.36
273 0.39
274 0.47
275 0.43
276 0.45
277 0.47
278 0.41
279 0.4
280 0.41
281 0.36
282 0.29
283 0.28
284 0.23
285 0.19
286 0.18
287 0.16
288 0.15
289 0.14
290 0.16
291 0.15
292 0.16
293 0.15
294 0.15
295 0.15
296 0.13
297 0.15
298 0.16
299 0.21
300 0.25
301 0.27
302 0.25
303 0.25
304 0.25
305 0.24
306 0.25
307 0.25
308 0.22
309 0.21
310 0.21
311 0.22
312 0.21
313 0.21
314 0.18
315 0.13
316 0.1
317 0.1
318 0.09
319 0.08
320 0.08
321 0.08