Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9P0Q1

Protein Details
Accession G9P0Q1    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAPRSLRVGKKTKRSHSQGQGWRFHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.833, nucl 11.5, mito 10, cyto_nucl 9.166, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MAPRSLRVGKKTKRSHSQGQGWRFHVQLQHHQPDATKRVPTYIQRVICKVGMQGRNTWIWVTQRYGCNKRVRLSSILCTSKNANK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.82
4 0.84
5 0.82
6 0.8
7 0.77
8 0.71
9 0.65
10 0.55
11 0.48
12 0.42
13 0.37
14 0.38
15 0.4
16 0.41
17 0.39
18 0.39
19 0.38
20 0.39
21 0.4
22 0.34
23 0.27
24 0.22
25 0.24
26 0.27
27 0.28
28 0.3
29 0.31
30 0.33
31 0.32
32 0.34
33 0.33
34 0.3
35 0.28
36 0.23
37 0.24
38 0.24
39 0.24
40 0.25
41 0.26
42 0.26
43 0.26
44 0.24
45 0.2
46 0.18
47 0.19
48 0.21
49 0.24
50 0.29
51 0.38
52 0.43
53 0.47
54 0.53
55 0.56
56 0.58
57 0.59
58 0.57
59 0.55
60 0.55
61 0.56
62 0.56
63 0.56
64 0.52
65 0.48