Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TIE0

Protein Details
Accession A0A1V8TIE0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-126QANKIEKASRQQRKQRKNRAKESRGVAKTKHydrophilic
NLS Segment(s)
PositionSequence
102-134EKASRQQRKQRKNRAKESRGVAKTKGGDKKKAK
Subcellular Location(s) mito 17, nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSDSQVTLRTRKFIRNPLLGRKQMVVDVLHPNRPNVSKDELRQKLSELYKSSKDQVSVFGFRTQFGGGKSTGFALVYDSNEAMKKFEPHYRLVRYGQANKIEKASRQQRKQRKNRAKESRGVAKTKGGDKKKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.68
4 0.72
5 0.78
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.29
16 0.33
17 0.32
18 0.32
19 0.33
20 0.34
21 0.33
22 0.28
23 0.32
24 0.31
25 0.36
26 0.46
27 0.47
28 0.47
29 0.45
30 0.43
31 0.43
32 0.41
33 0.41
34 0.34
35 0.33
36 0.35
37 0.36
38 0.38
39 0.32
40 0.31
41 0.26
42 0.28
43 0.28
44 0.25
45 0.25
46 0.25
47 0.24
48 0.22
49 0.23
50 0.18
51 0.15
52 0.13
53 0.14
54 0.1
55 0.1
56 0.1
57 0.09
58 0.09
59 0.07
60 0.07
61 0.07
62 0.08
63 0.08
64 0.09
65 0.08
66 0.09
67 0.1
68 0.1
69 0.1
70 0.1
71 0.12
72 0.14
73 0.2
74 0.22
75 0.26
76 0.33
77 0.36
78 0.39
79 0.39
80 0.43
81 0.44
82 0.48
83 0.48
84 0.5
85 0.49
86 0.45
87 0.48
88 0.44
89 0.4
90 0.43
91 0.48
92 0.49
93 0.56
94 0.65
95 0.71
96 0.8
97 0.89
98 0.9
99 0.91
100 0.91
101 0.93
102 0.94
103 0.9
104 0.88
105 0.85
106 0.85
107 0.8
108 0.74
109 0.65
110 0.61
111 0.6
112 0.6
113 0.61
114 0.57