Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8SVE9

Protein Details
Accession A0A1V8SVE9   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
85-104AKKAEKRKGKDKEKAKAEKKBasic
NLS Segment(s)
PositionSequence
77-134KKEWLEKIAKKAEKRKGKDKEKAKAEKKEDKKEDEADEKAKEEKVKALEKKQEDEKAK
162-164KKN
Subcellular Location(s) nucl 17.5, cyto_nucl 11.166, mito 6, cyto_mito 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MAKNIYHRRLVADSSAKACWICYKPSSTVLITPENDDWFHICPGHLLDRKFAIPQDAEDLEKKKREEAIEREIEEVKKEWLEKIAKKAEKRKGKDKEKAKAEKKEDKKEDEADEKAKEEKVKALEKKQEDEKAKVEGPRIFELQKHFWGMRMQKKRDLEVAKKNRERLRNGALFPAVPGGPPGGVKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.33
4 0.3
5 0.28
6 0.28
7 0.24
8 0.26
9 0.26
10 0.3
11 0.32
12 0.36
13 0.4
14 0.34
15 0.34
16 0.34
17 0.36
18 0.32
19 0.32
20 0.3
21 0.27
22 0.26
23 0.23
24 0.21
25 0.17
26 0.18
27 0.15
28 0.13
29 0.13
30 0.15
31 0.23
32 0.25
33 0.24
34 0.25
35 0.27
36 0.28
37 0.28
38 0.26
39 0.21
40 0.17
41 0.17
42 0.19
43 0.18
44 0.18
45 0.2
46 0.23
47 0.23
48 0.27
49 0.27
50 0.25
51 0.28
52 0.3
53 0.34
54 0.38
55 0.42
56 0.43
57 0.43
58 0.42
59 0.41
60 0.37
61 0.31
62 0.25
63 0.18
64 0.14
65 0.14
66 0.12
67 0.16
68 0.21
69 0.22
70 0.29
71 0.36
72 0.39
73 0.44
74 0.52
75 0.56
76 0.6
77 0.62
78 0.65
79 0.67
80 0.72
81 0.76
82 0.76
83 0.75
84 0.76
85 0.81
86 0.78
87 0.77
88 0.75
89 0.76
90 0.76
91 0.77
92 0.73
93 0.68
94 0.64
95 0.59
96 0.56
97 0.5
98 0.45
99 0.38
100 0.33
101 0.29
102 0.27
103 0.25
104 0.22
105 0.19
106 0.2
107 0.22
108 0.3
109 0.34
110 0.39
111 0.45
112 0.47
113 0.51
114 0.53
115 0.56
116 0.52
117 0.5
118 0.46
119 0.43
120 0.43
121 0.41
122 0.39
123 0.33
124 0.34
125 0.33
126 0.33
127 0.29
128 0.29
129 0.32
130 0.32
131 0.32
132 0.32
133 0.28
134 0.29
135 0.35
136 0.41
137 0.45
138 0.51
139 0.53
140 0.56
141 0.6
142 0.61
143 0.62
144 0.62
145 0.61
146 0.62
147 0.68
148 0.71
149 0.73
150 0.78
151 0.77
152 0.76
153 0.74
154 0.71
155 0.71
156 0.67
157 0.63
158 0.6
159 0.54
160 0.46
161 0.4
162 0.36
163 0.25
164 0.18
165 0.17
166 0.13
167 0.12