Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TCU0

Protein Details
Accession A0A1V8TCU0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-24QFPYPRKTSHPPPYQTPRASHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, mito 9, golg 4, extr 1, pero 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR008630  Glyco_trans_34  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0016757  F:glycosyltransferase activity  
Pfam View protein in Pfam  
PF05637  Glyco_transf_34  
Amino Acid Sequences MPTMQFPYPRKTSHPPPYQTPRASTFQRRRTLRNLAPYGLGILAIVLVFLYFLRSSSPTTPRPPPGTPPVVIVTTLDAKQSEHYKANIIENRKDYASRHGYATFFPNTTDYDLMSGVPSSWSTVPSMRHAMTLYPHTPWIFYLTSTALIMNPSQPLDLKVLDPRKLESLMIVDRPVVPPDSVIKSFSHLKGERVDFILTQDKEGLAGGSMLLRNGEWAKFFLDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.67
3 0.71
4 0.78
5 0.8
6 0.75
7 0.7
8 0.65
9 0.61
10 0.63
11 0.64
12 0.65
13 0.64
14 0.7
15 0.7
16 0.7
17 0.72
18 0.75
19 0.7
20 0.71
21 0.66
22 0.58
23 0.54
24 0.48
25 0.41
26 0.31
27 0.24
28 0.13
29 0.08
30 0.06
31 0.05
32 0.04
33 0.03
34 0.02
35 0.02
36 0.03
37 0.05
38 0.04
39 0.05
40 0.07
41 0.09
42 0.12
43 0.17
44 0.24
45 0.27
46 0.33
47 0.39
48 0.44
49 0.48
50 0.47
51 0.48
52 0.49
53 0.49
54 0.44
55 0.41
56 0.36
57 0.31
58 0.29
59 0.23
60 0.17
61 0.15
62 0.15
63 0.13
64 0.11
65 0.1
66 0.13
67 0.16
68 0.18
69 0.18
70 0.18
71 0.21
72 0.22
73 0.29
74 0.31
75 0.31
76 0.32
77 0.32
78 0.33
79 0.31
80 0.3
81 0.24
82 0.28
83 0.3
84 0.26
85 0.26
86 0.26
87 0.26
88 0.26
89 0.28
90 0.21
91 0.16
92 0.15
93 0.14
94 0.13
95 0.14
96 0.13
97 0.1
98 0.09
99 0.09
100 0.09
101 0.08
102 0.07
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.06
109 0.07
110 0.1
111 0.11
112 0.14
113 0.18
114 0.16
115 0.17
116 0.17
117 0.17
118 0.16
119 0.19
120 0.17
121 0.15
122 0.16
123 0.15
124 0.15
125 0.15
126 0.17
127 0.12
128 0.12
129 0.12
130 0.12
131 0.12
132 0.12
133 0.12
134 0.08
135 0.09
136 0.09
137 0.08
138 0.08
139 0.08
140 0.08
141 0.08
142 0.1
143 0.11
144 0.12
145 0.12
146 0.18
147 0.23
148 0.27
149 0.28
150 0.28
151 0.29
152 0.29
153 0.27
154 0.21
155 0.21
156 0.19
157 0.2
158 0.19
159 0.16
160 0.17
161 0.18
162 0.18
163 0.15
164 0.12
165 0.12
166 0.16
167 0.21
168 0.21
169 0.21
170 0.2
171 0.23
172 0.29
173 0.3
174 0.34
175 0.3
176 0.32
177 0.38
178 0.41
179 0.39
180 0.36
181 0.35
182 0.26
183 0.29
184 0.35
185 0.28
186 0.26
187 0.25
188 0.22
189 0.21
190 0.21
191 0.17
192 0.08
193 0.08
194 0.07
195 0.08
196 0.09
197 0.09
198 0.09
199 0.08
200 0.11
201 0.14
202 0.15
203 0.14
204 0.15