Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V8T286

Protein Details
Accession A0A1V8T286    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-74YLNEAGKKVKRTQRVRRTVVKKRENPRVAEHydrophilic
NLS Segment(s)
PositionSequence
51-80KKVKRTQRVRRTVVKKRENPRVAERRQWAK
Subcellular Location(s) cyto_nucl 14, nucl 13.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017334  eIF3_g  
IPR024675  eIF3g_N  
IPR034240  eIF3G_RRM  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0033290  C:eukaryotic 48S preinitiation complex  
GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0003723  F:RNA binding  
GO:0003743  F:translation initiation factor activity  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
Pfam View protein in Pfam  
PF12353  eIF3g  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12933  eIF3G  
cd12408  RRM_eIF3G_like  
Amino Acid Sequences MATAVQNTPGRTDWAEDGEPELASVLPQPVTTKNKDGTETVVSYYLNEAGKKVKRTQRVRRTVVKKRENPRVAERRQWAKMGPEANKPAGPGDTTTLGENIIFRPQVGFKAGGVQEKAPEEEKKNDALKKMQIKCRICSGDHFTTKCPFKDSMAAPEEGTGEGAGGEGGGDGIDAAGGLGSTTGAYVPIHLRNGRKGEGERMGGKFERDDLATLRVTNVSELAEEQDLRDMFERHGRVTRVFLAKDRETGRAKGFAFVSYADRADAARACERMDGYGFGHLILRVEFAKKADGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.24
4 0.25
5 0.23
6 0.22
7 0.18
8 0.16
9 0.1
10 0.09
11 0.1
12 0.1
13 0.09
14 0.09
15 0.12
16 0.19
17 0.25
18 0.29
19 0.34
20 0.37
21 0.41
22 0.43
23 0.42
24 0.39
25 0.38
26 0.35
27 0.31
28 0.27
29 0.24
30 0.22
31 0.22
32 0.21
33 0.17
34 0.16
35 0.16
36 0.22
37 0.28
38 0.32
39 0.4
40 0.44
41 0.52
42 0.62
43 0.72
44 0.76
45 0.8
46 0.83
47 0.84
48 0.87
49 0.87
50 0.87
51 0.87
52 0.85
53 0.83
54 0.87
55 0.82
56 0.78
57 0.78
58 0.78
59 0.72
60 0.72
61 0.71
62 0.68
63 0.65
64 0.61
65 0.52
66 0.46
67 0.46
68 0.44
69 0.4
70 0.39
71 0.4
72 0.4
73 0.38
74 0.35
75 0.31
76 0.25
77 0.21
78 0.15
79 0.14
80 0.13
81 0.13
82 0.14
83 0.12
84 0.12
85 0.11
86 0.11
87 0.09
88 0.09
89 0.09
90 0.08
91 0.09
92 0.1
93 0.11
94 0.13
95 0.12
96 0.1
97 0.17
98 0.18
99 0.19
100 0.19
101 0.18
102 0.18
103 0.18
104 0.2
105 0.16
106 0.17
107 0.18
108 0.22
109 0.23
110 0.26
111 0.31
112 0.32
113 0.32
114 0.32
115 0.36
116 0.41
117 0.46
118 0.47
119 0.51
120 0.52
121 0.51
122 0.54
123 0.51
124 0.42
125 0.39
126 0.4
127 0.39
128 0.4
129 0.4
130 0.34
131 0.37
132 0.4
133 0.36
134 0.31
135 0.24
136 0.21
137 0.26
138 0.26
139 0.27
140 0.27
141 0.27
142 0.23
143 0.23
144 0.22
145 0.16
146 0.15
147 0.08
148 0.05
149 0.04
150 0.04
151 0.03
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.01
164 0.01
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.02
171 0.03
172 0.03
173 0.05
174 0.07
175 0.09
176 0.13
177 0.16
178 0.18
179 0.23
180 0.27
181 0.28
182 0.29
183 0.29
184 0.32
185 0.33
186 0.35
187 0.33
188 0.3
189 0.32
190 0.29
191 0.28
192 0.22
193 0.2
194 0.18
195 0.14
196 0.15
197 0.13
198 0.15
199 0.16
200 0.15
201 0.15
202 0.14
203 0.14
204 0.13
205 0.12
206 0.09
207 0.08
208 0.08
209 0.1
210 0.1
211 0.1
212 0.09
213 0.13
214 0.13
215 0.14
216 0.16
217 0.15
218 0.15
219 0.22
220 0.23
221 0.21
222 0.27
223 0.28
224 0.28
225 0.3
226 0.36
227 0.35
228 0.35
229 0.37
230 0.39
231 0.39
232 0.44
233 0.42
234 0.42
235 0.4
236 0.43
237 0.41
238 0.41
239 0.39
240 0.37
241 0.36
242 0.29
243 0.27
244 0.24
245 0.25
246 0.2
247 0.2
248 0.16
249 0.15
250 0.14
251 0.16
252 0.17
253 0.18
254 0.2
255 0.21
256 0.21
257 0.23
258 0.24
259 0.23
260 0.23
261 0.2
262 0.17
263 0.21
264 0.2
265 0.17
266 0.18
267 0.16
268 0.16
269 0.14
270 0.15
271 0.12
272 0.15
273 0.16
274 0.16