Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V8SZ12

Protein Details
Accession A0A1V8SZ12    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
79-104KMEEKMHKKRVERLKRREKRNKLLKSBasic
NLS Segment(s)
PositionSequence
59-104RKVQAIKDKRAAEEEKERFAKMEEKMHKKRVERLKRREKRNKLLKS
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MASTTAQAPVHGQRVNGKQWHGTRKAFRPTSGLTSYDIRKKRTAHEAEVSKTETEMKERKVQAIKDKRAAEEEKERFAKMEEKMHKKRVERLKRREKRNKLLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.42
4 0.4
5 0.41
6 0.47
7 0.55
8 0.54
9 0.55
10 0.56
11 0.6
12 0.68
13 0.63
14 0.57
15 0.53
16 0.5
17 0.49
18 0.44
19 0.37
20 0.29
21 0.3
22 0.33
23 0.36
24 0.37
25 0.33
26 0.36
27 0.37
28 0.39
29 0.45
30 0.46
31 0.43
32 0.46
33 0.47
34 0.44
35 0.45
36 0.41
37 0.31
38 0.26
39 0.23
40 0.16
41 0.17
42 0.19
43 0.19
44 0.25
45 0.26
46 0.31
47 0.34
48 0.37
49 0.43
50 0.49
51 0.52
52 0.52
53 0.53
54 0.49
55 0.5
56 0.49
57 0.44
58 0.44
59 0.41
60 0.41
61 0.41
62 0.4
63 0.35
64 0.35
65 0.35
66 0.29
67 0.35
68 0.38
69 0.46
70 0.54
71 0.62
72 0.67
73 0.65
74 0.71
75 0.72
76 0.74
77 0.75
78 0.79
79 0.81
80 0.85
81 0.92
82 0.94
83 0.93
84 0.93