Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8SEY9

Protein Details
Accession A0A1V8SEY9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
148-176AEVDGKRRQVRRVRCNKDKKELKIRLVYDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012674  Calycin  
Amino Acid Sequences MAVPLTTNAQNFSGTYTMNKTLGDSSDEMLKMQNIGWIVRKVIANSAVTTTLKQYTDDKGLQKIDLEQLSTGGMKTDEERFLDWEWRDTTDKVWGKVKGRARLIKVDTITDPYLKEGWSQDCLEGEVLENEIESLTEGWKVLQIWGFAEVDGKRRQVRRVRCNKDKKELKIRLVYDWQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.19
4 0.21
5 0.22
6 0.21
7 0.2
8 0.21
9 0.21
10 0.22
11 0.19
12 0.17
13 0.21
14 0.21
15 0.2
16 0.18
17 0.17
18 0.14
19 0.13
20 0.14
21 0.1
22 0.11
23 0.16
24 0.16
25 0.16
26 0.19
27 0.2
28 0.18
29 0.21
30 0.23
31 0.19
32 0.19
33 0.19
34 0.19
35 0.18
36 0.18
37 0.17
38 0.17
39 0.16
40 0.17
41 0.18
42 0.18
43 0.23
44 0.27
45 0.27
46 0.28
47 0.28
48 0.27
49 0.25
50 0.23
51 0.22
52 0.19
53 0.17
54 0.13
55 0.12
56 0.12
57 0.12
58 0.1
59 0.06
60 0.06
61 0.05
62 0.07
63 0.09
64 0.1
65 0.11
66 0.12
67 0.13
68 0.14
69 0.19
70 0.17
71 0.17
72 0.17
73 0.19
74 0.2
75 0.18
76 0.18
77 0.22
78 0.24
79 0.24
80 0.27
81 0.28
82 0.29
83 0.35
84 0.4
85 0.38
86 0.42
87 0.45
88 0.44
89 0.47
90 0.47
91 0.45
92 0.4
93 0.35
94 0.29
95 0.28
96 0.26
97 0.2
98 0.18
99 0.15
100 0.15
101 0.13
102 0.14
103 0.13
104 0.14
105 0.16
106 0.17
107 0.16
108 0.16
109 0.16
110 0.15
111 0.12
112 0.11
113 0.08
114 0.08
115 0.07
116 0.06
117 0.06
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.06
124 0.06
125 0.06
126 0.08
127 0.08
128 0.1
129 0.12
130 0.12
131 0.12
132 0.14
133 0.14
134 0.12
135 0.16
136 0.15
137 0.18
138 0.22
139 0.25
140 0.29
141 0.33
142 0.42
143 0.48
144 0.58
145 0.63
146 0.71
147 0.77
148 0.82
149 0.89
150 0.9
151 0.91
152 0.9
153 0.89
154 0.89
155 0.88
156 0.85
157 0.83
158 0.77
159 0.73