Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8SDU6

Protein Details
Accession A0A1V8SDU6    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-82DATPTKKPKATPKKRGEKVVQAEHydrophilic
NLS Segment(s)
PositionSequence
37-48KKGTKATPKKRK
65-76KKPKATPKKRGE
Subcellular Location(s) mito 9cyto_nucl 9, nucl 8.5, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MSNVSLASASTIYSRTLKLVTNFNGTEDGGDAEGTPKKGTKATPKKRKSTGEDGEDDNDDATPTKKPKATPKKRGEKVVQAEKDGEGEEQKVKDETEGEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.19
5 0.21
6 0.27
7 0.28
8 0.32
9 0.32
10 0.31
11 0.31
12 0.27
13 0.24
14 0.17
15 0.15
16 0.09
17 0.08
18 0.07
19 0.08
20 0.1
21 0.1
22 0.1
23 0.1
24 0.11
25 0.14
26 0.18
27 0.27
28 0.36
29 0.46
30 0.57
31 0.64
32 0.7
33 0.75
34 0.79
35 0.74
36 0.73
37 0.69
38 0.63
39 0.57
40 0.51
41 0.45
42 0.38
43 0.31
44 0.21
45 0.15
46 0.1
47 0.08
48 0.08
49 0.1
50 0.12
51 0.16
52 0.18
53 0.22
54 0.34
55 0.45
56 0.55
57 0.62
58 0.71
59 0.78
60 0.81
61 0.86
62 0.82
63 0.8
64 0.79
65 0.78
66 0.7
67 0.61
68 0.57
69 0.48
70 0.43
71 0.33
72 0.25
73 0.16
74 0.16
75 0.18
76 0.17
77 0.18
78 0.19
79 0.18
80 0.18
81 0.19