Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TJF0

Protein Details
Accession A0A1V8TJF0    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
94-116SAEGEGKSKKRKRGKEEGGEGEGBasic
NLS Segment(s)
PositionSequence
99-109GKSKKRKRGKE
425-432RKGKRKAE
Subcellular Location(s) cyto_nucl 15.333, cyto 15, nucl 11.5, mito_nucl 6.832
Family & Domain DBs
InterPro View protein in InterPro  
IPR019544  Tetratricopeptide_SHNi-TPR_dom  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF10516  SHNi-TPR  
Amino Acid Sequences MASANPALNDAPIDTPTDPSSSLPQLLAQAQKLYALKRYAEAADLYSEAAALHDEVHGEMALENAEVLFQYGRCLYYVGVGKSDVLGGKVAATSAEGEGKSKKRKRGKEEGGEGEGLIGKAMAEGSGVGEVKSEQAAGKPFFQITGDENWTDSEGEEDDGDDAQTGEAEEEEEEQDDFSLSYEILDLARVLFRRRLDIVLAPPTDPPAPLAGEARHLTDRLSEIHDLQAEVKLENEQFHDAVADCRAALTLKLQLYPPESGMLAEAHYKLAIALDFASLPVSAPEGEEVGEPGEKPAKKEDGKVDEELKAEAVSEMEAAISSCQLRIAKEEAALSGLPTAKQASAKAGIADVKSMVSEMKNRLVDLKTPTHGPALSALALQGDGETGEELKGVMGKAMVAGSKAESERVVQEAVSGARDLGGLVRKGKRKAETNGEGGEGKKAKVEDGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.18
4 0.19
5 0.19
6 0.19
7 0.24
8 0.23
9 0.24
10 0.22
11 0.22
12 0.23
13 0.27
14 0.29
15 0.25
16 0.24
17 0.23
18 0.27
19 0.28
20 0.27
21 0.29
22 0.28
23 0.28
24 0.27
25 0.31
26 0.27
27 0.27
28 0.25
29 0.21
30 0.19
31 0.18
32 0.17
33 0.13
34 0.12
35 0.09
36 0.08
37 0.07
38 0.06
39 0.06
40 0.06
41 0.07
42 0.07
43 0.08
44 0.07
45 0.07
46 0.07
47 0.07
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.04
54 0.05
55 0.06
56 0.05
57 0.08
58 0.09
59 0.1
60 0.1
61 0.11
62 0.1
63 0.15
64 0.21
65 0.2
66 0.2
67 0.2
68 0.2
69 0.19
70 0.21
71 0.15
72 0.1
73 0.1
74 0.08
75 0.09
76 0.08
77 0.08
78 0.06
79 0.06
80 0.07
81 0.07
82 0.1
83 0.1
84 0.12
85 0.18
86 0.25
87 0.35
88 0.41
89 0.5
90 0.57
91 0.66
92 0.74
93 0.79
94 0.83
95 0.82
96 0.85
97 0.81
98 0.74
99 0.65
100 0.55
101 0.44
102 0.35
103 0.24
104 0.15
105 0.08
106 0.05
107 0.05
108 0.05
109 0.04
110 0.03
111 0.03
112 0.04
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.07
119 0.07
120 0.07
121 0.06
122 0.08
123 0.13
124 0.14
125 0.16
126 0.16
127 0.16
128 0.16
129 0.16
130 0.16
131 0.14
132 0.17
133 0.18
134 0.17
135 0.17
136 0.17
137 0.17
138 0.16
139 0.13
140 0.09
141 0.07
142 0.08
143 0.07
144 0.07
145 0.07
146 0.06
147 0.06
148 0.05
149 0.05
150 0.04
151 0.04
152 0.04
153 0.04
154 0.03
155 0.04
156 0.04
157 0.05
158 0.05
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.05
165 0.05
166 0.05
167 0.04
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.04
174 0.04
175 0.06
176 0.07
177 0.08
178 0.12
179 0.12
180 0.15
181 0.16
182 0.17
183 0.17
184 0.19
185 0.21
186 0.23
187 0.23
188 0.21
189 0.2
190 0.2
191 0.19
192 0.16
193 0.13
194 0.09
195 0.08
196 0.09
197 0.1
198 0.09
199 0.12
200 0.12
201 0.13
202 0.13
203 0.12
204 0.12
205 0.11
206 0.12
207 0.1
208 0.13
209 0.11
210 0.11
211 0.13
212 0.13
213 0.12
214 0.11
215 0.12
216 0.1
217 0.09
218 0.09
219 0.09
220 0.09
221 0.1
222 0.11
223 0.1
224 0.09
225 0.09
226 0.09
227 0.08
228 0.08
229 0.08
230 0.07
231 0.05
232 0.05
233 0.06
234 0.05
235 0.05
236 0.06
237 0.09
238 0.1
239 0.11
240 0.12
241 0.13
242 0.15
243 0.16
244 0.15
245 0.12
246 0.11
247 0.1
248 0.11
249 0.09
250 0.07
251 0.08
252 0.08
253 0.07
254 0.07
255 0.07
256 0.06
257 0.06
258 0.06
259 0.04
260 0.04
261 0.05
262 0.05
263 0.05
264 0.05
265 0.05
266 0.05
267 0.04
268 0.05
269 0.05
270 0.05
271 0.05
272 0.05
273 0.05
274 0.05
275 0.06
276 0.06
277 0.06
278 0.06
279 0.07
280 0.13
281 0.13
282 0.15
283 0.19
284 0.26
285 0.27
286 0.33
287 0.4
288 0.41
289 0.44
290 0.46
291 0.44
292 0.39
293 0.38
294 0.33
295 0.25
296 0.18
297 0.14
298 0.11
299 0.08
300 0.06
301 0.05
302 0.05
303 0.04
304 0.04
305 0.04
306 0.04
307 0.05
308 0.05
309 0.05
310 0.08
311 0.09
312 0.09
313 0.12
314 0.15
315 0.16
316 0.17
317 0.18
318 0.16
319 0.16
320 0.16
321 0.13
322 0.12
323 0.12
324 0.1
325 0.1
326 0.11
327 0.11
328 0.13
329 0.13
330 0.15
331 0.17
332 0.18
333 0.17
334 0.18
335 0.19
336 0.18
337 0.18
338 0.14
339 0.11
340 0.1
341 0.1
342 0.1
343 0.09
344 0.14
345 0.17
346 0.24
347 0.25
348 0.25
349 0.3
350 0.3
351 0.33
352 0.34
353 0.36
354 0.31
355 0.32
356 0.33
357 0.32
358 0.3
359 0.26
360 0.23
361 0.2
362 0.18
363 0.16
364 0.15
365 0.12
366 0.11
367 0.1
368 0.07
369 0.05
370 0.04
371 0.04
372 0.05
373 0.05
374 0.05
375 0.05
376 0.05
377 0.06
378 0.07
379 0.07
380 0.07
381 0.07
382 0.07
383 0.08
384 0.09
385 0.09
386 0.08
387 0.09
388 0.09
389 0.13
390 0.13
391 0.14
392 0.13
393 0.15
394 0.16
395 0.18
396 0.18
397 0.13
398 0.14
399 0.16
400 0.16
401 0.15
402 0.13
403 0.11
404 0.11
405 0.11
406 0.1
407 0.11
408 0.16
409 0.18
410 0.24
411 0.32
412 0.39
413 0.45
414 0.52
415 0.56
416 0.59
417 0.65
418 0.69
419 0.69
420 0.68
421 0.64
422 0.6
423 0.54
424 0.46
425 0.45
426 0.37
427 0.3
428 0.28
429 0.26