Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TCC2

Protein Details
Accession A0A1V8TCC2    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
129-151VRMGREPPRPKPRPPPWPRDPGNBasic
NLS Segment(s)
PositionSequence
89-96PVRPRPPK
133-148REPPRPKPRPPPWPRD
Subcellular Location(s) mito 14.5, cyto_mito 9.5, nucl 9
Family & Domain DBs
Amino Acid Sequences MFFTSFAIPIRQQELFTTIRRRDQAYSEAPSIYHHTALTQLAAAGRILPADPTPIPQQVNLSSMASTYRNTPSRVDPQPRDPGNGSGRPVRPRPPKPPQPRDGDYRYPSTNASNFGPYSAVVTADQPSVRMGREPPRPKPRPPPWPRDPGNGRLSREAVGMNFDERRMRRMAEPQPRDPGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.3
4 0.35
5 0.35
6 0.41
7 0.43
8 0.45
9 0.43
10 0.44
11 0.46
12 0.44
13 0.45
14 0.4
15 0.38
16 0.34
17 0.33
18 0.34
19 0.28
20 0.23
21 0.17
22 0.16
23 0.17
24 0.18
25 0.16
26 0.11
27 0.09
28 0.09
29 0.09
30 0.09
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.08
38 0.09
39 0.11
40 0.14
41 0.17
42 0.18
43 0.18
44 0.2
45 0.19
46 0.2
47 0.18
48 0.16
49 0.13
50 0.12
51 0.13
52 0.12
53 0.11
54 0.12
55 0.17
56 0.19
57 0.21
58 0.23
59 0.26
60 0.33
61 0.4
62 0.45
63 0.42
64 0.45
65 0.53
66 0.51
67 0.5
68 0.43
69 0.41
70 0.39
71 0.38
72 0.33
73 0.31
74 0.33
75 0.34
76 0.35
77 0.38
78 0.43
79 0.47
80 0.54
81 0.58
82 0.65
83 0.72
84 0.79
85 0.77
86 0.76
87 0.73
88 0.7
89 0.67
90 0.64
91 0.56
92 0.51
93 0.45
94 0.38
95 0.36
96 0.32
97 0.27
98 0.22
99 0.21
100 0.19
101 0.18
102 0.17
103 0.17
104 0.13
105 0.13
106 0.11
107 0.1
108 0.08
109 0.09
110 0.1
111 0.11
112 0.11
113 0.09
114 0.1
115 0.11
116 0.11
117 0.12
118 0.14
119 0.21
120 0.32
121 0.39
122 0.48
123 0.58
124 0.63
125 0.68
126 0.75
127 0.77
128 0.78
129 0.8
130 0.8
131 0.77
132 0.82
133 0.79
134 0.78
135 0.74
136 0.71
137 0.72
138 0.69
139 0.64
140 0.58
141 0.55
142 0.46
143 0.41
144 0.34
145 0.25
146 0.22
147 0.2
148 0.18
149 0.18
150 0.18
151 0.24
152 0.24
153 0.28
154 0.27
155 0.29
156 0.31
157 0.39
158 0.48
159 0.52
160 0.59
161 0.61