Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V8T384

Protein Details
Accession A0A1V8T384    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-36HEKVDSKREAKRLKRRNTEVRYEEBasic
NLS Segment(s)
PositionSequence
20-27REAKRLKR
Subcellular Location(s) cyto 14, cyto_nucl 10.333, mito 6.5, mito_nucl 6.166, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MAALIIAGVIALHEKVDSKREAKRLKRRNTEVRYEELQKETKLRLERTDSAGGQGRRSESLERERQGEKRGGGLPGYEEVAGSGGRGRGEGVRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.14
4 0.18
5 0.21
6 0.28
7 0.37
8 0.46
9 0.55
10 0.64
11 0.7
12 0.76
13 0.83
14 0.86
15 0.87
16 0.85
17 0.84
18 0.76
19 0.72
20 0.66
21 0.6
22 0.53
23 0.46
24 0.41
25 0.32
26 0.31
27 0.27
28 0.27
29 0.27
30 0.26
31 0.26
32 0.29
33 0.31
34 0.33
35 0.35
36 0.3
37 0.28
38 0.32
39 0.29
40 0.24
41 0.23
42 0.19
43 0.17
44 0.19
45 0.19
46 0.18
47 0.26
48 0.32
49 0.32
50 0.35
51 0.37
52 0.38
53 0.41
54 0.41
55 0.33
56 0.31
57 0.33
58 0.3
59 0.27
60 0.24
61 0.21
62 0.18
63 0.18
64 0.13
65 0.1
66 0.09
67 0.1
68 0.09
69 0.07
70 0.08
71 0.09
72 0.09
73 0.09
74 0.11