FuNGI

A0A1V8STC7

Protein Details

Accession

A0A1V8STC7

Localization Confidence

Medium

Confidence Score

10.4

NoLS Segment(s)

Position	Sequence	Protein Nature
41-65	DSNPHVPSRRAPFRRRRWQIGMFLF	Hydrophilic
395-414	EQSHGHRRRKRASTLKDILH	Basic
470-518	RAETMPVGRKRQRRHSHQGQGSALFSDLLKREWWRSRRKEKDGDGEADG	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 22, E.R. 2, nucl 1, extr 1, vacu 1

Family & Domain DBs

InterPro	View protein in InterPro IPR008521 Mg_trans_NIPA
Gene Ontology	GO:0016020 C:membrane GO:0015095 F:magnesium ion transmembrane transporter activity
Pfam	View protein in Pfam PF05653 Mg_trans_NIPA

Amino Acid Sequences

MASSDWGAGSTVALGIVVGLLSTAIQSIGLTLQRKSHMLEDSNPHVPSRRAPFRRRRWQIGMFLFLIANIVGSTIQITTLPLPLLSTLQASGLVFNSIMASLILKEQWTWRTVLGTVLVAGGAVLISLFSALPEPSHNLGQLLELLRQKGFLVWFVLSLVFVLAVLVVDFSLRHVLAVHRRESPRILLIRGMAYGMLSGILSAHALLLAKSAVELIVRSLADKNNQFRHYQSWMLVLAFLVLALTQLYYLHLGLKLVSTSVLYPFVFCIYNLVAILDGLIYFRQMDTLPPLHAGLIGVGTVILLSGVLALSWRLDDTPTGDENSDTGHYKHQMGKSEIPQTVLAPGMGFVGEPSESDGTSSAALTDEETAVQDIASERSPLLPAVGRRHGSTTSEQSHGHRRRKRASTLKDILHMWEEDEDADDILPAYGAIPSRPLSAGASRRRQSGADLLDRANDAEDESSLPEGFARAETMPVGRKRQRRHSHQGQGSALFSDLLKREWWRSRRKEKDGDGEADG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.05
2	0.04
3	0.04
4	0.04
5	0.03
6	0.03
7	0.03
8	0.03
9	0.03
10	0.03
11	0.03
12	0.04
13	0.04
14	0.05
15	0.08
16	0.12
17	0.15
18	0.16
19	0.21
20	0.23
21	0.25
22	0.27
23	0.3
24	0.32
25	0.34
26	0.39
27	0.41
28	0.44
29	0.49
30	0.47
31	0.43
32	0.4
33	0.38
34	0.39
35	0.42
36	0.47
37	0.5
38	0.6
39	0.7
40	0.77
41	0.87
42	0.89
43	0.88
44	0.86
45	0.85
46	0.84
47	0.79
48	0.73
49	0.62
50	0.54
51	0.44
52	0.35
53	0.28
54	0.17
55	0.12
56	0.06
57	0.06
58	0.04
59	0.04
60	0.05
61	0.05
62	0.05
63	0.05
64	0.07
65	0.07
66	0.09
67	0.1
68	0.09
69	0.09
70	0.1
71	0.1
72	0.1
73	0.1
74	0.08
75	0.08
76	0.1
77	0.09
78	0.1
79	0.09
80	0.09
81	0.08
82	0.08
83	0.08
84	0.06
85	0.07
86	0.06
87	0.06
88	0.06
89	0.07
90	0.07
91	0.07
92	0.08
93	0.12
94	0.15
95	0.16
96	0.17
97	0.17
98	0.18
99	0.18
100	0.19
101	0.16
102	0.13
103	0.12
104	0.1
105	0.09
106	0.07
107	0.06
108	0.05
109	0.03
110	0.02
111	0.02
112	0.02
113	0.02
114	0.02
115	0.02
116	0.03
117	0.04
118	0.04
119	0.05
120	0.07
121	0.11
122	0.13
123	0.14
124	0.14
125	0.13
126	0.14
127	0.14
128	0.15
129	0.13
130	0.15
131	0.16
132	0.17
133	0.16
134	0.16
135	0.16
136	0.15
137	0.14
138	0.11
139	0.12
140	0.11
141	0.11
142	0.11
143	0.11
144	0.09
145	0.08
146	0.07
147	0.04
148	0.04
149	0.03
150	0.03
151	0.03
152	0.02
153	0.02
154	0.02
155	0.03
156	0.03
157	0.03
158	0.05
159	0.05
160	0.05
161	0.06
162	0.1
163	0.18
164	0.23
165	0.25
166	0.3
167	0.31
168	0.34
169	0.35
170	0.34
171	0.32
172	0.3
173	0.29
174	0.23
175	0.23
176	0.22
177	0.2
178	0.17
179	0.1
180	0.08
181	0.07
182	0.05
183	0.04
184	0.03
185	0.03
186	0.03
187	0.03
188	0.03
189	0.03
190	0.03
191	0.03
192	0.03
193	0.03
194	0.04
195	0.04
196	0.04
197	0.04
198	0.04
199	0.03
200	0.03
201	0.04
202	0.04
203	0.06
204	0.06
205	0.07
206	0.09
207	0.1
208	0.15
209	0.19
210	0.24
211	0.29
212	0.32
213	0.32
214	0.31
215	0.34
216	0.34
217	0.31
218	0.27
219	0.21
220	0.2
221	0.19
222	0.18
223	0.13
224	0.09
225	0.07
226	0.06
227	0.04
228	0.03
229	0.03
230	0.02
231	0.02
232	0.02
233	0.02
234	0.03
235	0.04
236	0.04
237	0.05
238	0.05
239	0.05
240	0.05
241	0.06
242	0.05
243	0.05
244	0.05
245	0.04
246	0.04
247	0.05
248	0.07
249	0.07
250	0.07
251	0.07
252	0.08
253	0.08
254	0.07
255	0.09
256	0.07
257	0.08
258	0.07
259	0.07
260	0.06
261	0.05
262	0.06
263	0.04
264	0.03
265	0.03
266	0.03
267	0.03
268	0.03
269	0.03
270	0.04
271	0.04
272	0.05
273	0.09
274	0.1
275	0.11
276	0.11
277	0.12
278	0.11
279	0.11
280	0.1
281	0.06
282	0.05
283	0.04
284	0.03
285	0.03
286	0.03
287	0.02
288	0.02
289	0.02
290	0.02
291	0.02
292	0.02
293	0.02
294	0.02
295	0.02
296	0.02
297	0.03
298	0.03
299	0.03
300	0.03
301	0.04
302	0.05
303	0.07
304	0.1
305	0.11
306	0.12
307	0.12
308	0.12
309	0.12
310	0.13
311	0.12
312	0.11
313	0.11
314	0.13
315	0.15
316	0.18
317	0.23
318	0.25
319	0.3
320	0.33
321	0.38
322	0.39
323	0.44
324	0.42
325	0.39
326	0.36
327	0.29
328	0.26
329	0.21
330	0.16
331	0.09
332	0.08
333	0.06
334	0.06
335	0.05
336	0.04
337	0.04
338	0.04
339	0.04
340	0.07
341	0.07
342	0.07
343	0.08
344	0.08
345	0.08
346	0.08
347	0.08
348	0.06
349	0.06
350	0.06
351	0.06
352	0.07
353	0.06
354	0.06
355	0.07
356	0.07
357	0.06
358	0.06
359	0.06
360	0.06
361	0.08
362	0.08
363	0.08
364	0.08
365	0.09
366	0.1
367	0.09
368	0.1
369	0.12
370	0.15
371	0.21
372	0.28
373	0.28
374	0.29
375	0.32
376	0.32
377	0.32
378	0.33
379	0.34
380	0.31
381	0.33
382	0.34
383	0.35
384	0.44
385	0.5
386	0.55
387	0.54
388	0.59
389	0.66
390	0.73
391	0.79
392	0.79
393	0.78
394	0.79
395	0.81
396	0.75
397	0.69
398	0.62
399	0.53
400	0.46
401	0.37
402	0.27
403	0.2
404	0.17
405	0.13
406	0.14
407	0.12
408	0.09
409	0.09
410	0.08
411	0.07
412	0.06
413	0.06
414	0.04
415	0.04
416	0.06
417	0.06
418	0.06
419	0.09
420	0.1
421	0.12
422	0.12
423	0.13
424	0.14
425	0.21
426	0.3
427	0.37
428	0.46
429	0.46
430	0.49
431	0.5
432	0.48
433	0.45
434	0.44
435	0.42
436	0.39
437	0.4
438	0.37
439	0.37
440	0.37
441	0.33
442	0.26
443	0.19
444	0.13
445	0.11
446	0.11
447	0.1
448	0.11
449	0.12
450	0.11
451	0.1
452	0.1
453	0.1
454	0.1
455	0.09
456	0.1
457	0.09
458	0.1
459	0.12
460	0.15
461	0.22
462	0.27
463	0.36
464	0.42
465	0.5
466	0.58
467	0.68
468	0.76
469	0.78
470	0.84
471	0.85
472	0.88
473	0.87
474	0.86
475	0.8
476	0.72
477	0.63
478	0.53
479	0.42
480	0.32
481	0.24
482	0.21
483	0.18
484	0.16
485	0.19
486	0.22
487	0.3
488	0.39
489	0.48
490	0.54
491	0.63
492	0.73
493	0.81
494	0.87
495	0.89
496	0.88
497	0.9
498	0.87

A0A1V8STC7

3D AlphaFold-predicted Structure Viewer