Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8S8A5

Protein Details
Accession A0A1V8S8A5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
94-118AKQYKTKQDEMEKWKKKNKIQVVQQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 11.666, mito_nucl 8.833, cyto 8, cyto_pero 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR027235  PFD2  
IPR002777  PFD_beta-like  
IPR009053  Prefoldin  
Gene Ontology GO:0016272  C:prefoldin complex  
GO:0051082  F:unfolded protein binding  
GO:0006457  P:protein folding  
Pfam View protein in Pfam  
PF01920  Prefoldin_2  
Amino Acid Sequences MAAQQQVSAKKQQELQTQYSNFKDTLQNIASQIGNVEQEVDEHKLVLETLTPLPSDRKCFRMINGVLVERTVGDVLPTLQSNADNMSKVLEELAKQYKTKQDEMEKWKKKNKIQVVQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.56
4 0.56
5 0.57
6 0.53
7 0.48
8 0.39
9 0.36
10 0.34
11 0.27
12 0.3
13 0.26
14 0.26
15 0.24
16 0.26
17 0.23
18 0.19
19 0.17
20 0.11
21 0.11
22 0.08
23 0.09
24 0.06
25 0.07
26 0.09
27 0.11
28 0.1
29 0.09
30 0.09
31 0.09
32 0.09
33 0.08
34 0.06
35 0.06
36 0.07
37 0.08
38 0.08
39 0.08
40 0.12
41 0.13
42 0.19
43 0.18
44 0.2
45 0.24
46 0.25
47 0.25
48 0.31
49 0.3
50 0.29
51 0.3
52 0.28
53 0.24
54 0.23
55 0.22
56 0.12
57 0.12
58 0.07
59 0.04
60 0.04
61 0.04
62 0.05
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.08
69 0.1
70 0.11
71 0.1
72 0.1
73 0.11
74 0.11
75 0.1
76 0.11
77 0.09
78 0.09
79 0.13
80 0.2
81 0.22
82 0.22
83 0.26
84 0.33
85 0.36
86 0.4
87 0.43
88 0.46
89 0.53
90 0.63
91 0.7
92 0.72
93 0.76
94 0.8
95 0.81
96 0.79
97 0.8
98 0.81