Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TH61

Protein Details
Accession A0A1V8TH61   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
161-188NGEKKEAKGPAKKKEPKKAQTESGEPRRBasic
NLS Segment(s)
PositionSequence
97-194EKRKAEDEGEKEEEKEEGKGAKKAKKGGAAKGAKADAAKDDKEGEEKAAPKKKGRPAKAATGAANGEKKEAKGPAKKKEPKKAQTESGEPRRSGRNKA
Subcellular Location(s) mito 13, nucl 9, cyto_nucl 7.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MSEIKEGDKVSWSWGSGQPGGTAAEVAKEGEISITSKKGNEIKKKASPDNPAVHIERPGNDVVKRASELQVDEKGSSSKGGAEKKDEGANGEASAGEKRKAEDEGEKEEEKEEGKGAKKAKKGGAAKGAKADAAKDDKEGEEKAAPKKKGRPAKAATGAANGEKKEAKGPAKKKEPKKAQTESGEPRRSGRNKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.29
4 0.29
5 0.25
6 0.24
7 0.24
8 0.2
9 0.16
10 0.11
11 0.1
12 0.09
13 0.09
14 0.08
15 0.07
16 0.06
17 0.06
18 0.07
19 0.08
20 0.1
21 0.12
22 0.13
23 0.13
24 0.18
25 0.25
26 0.33
27 0.41
28 0.48
29 0.53
30 0.6
31 0.67
32 0.7
33 0.7
34 0.68
35 0.66
36 0.63
37 0.59
38 0.55
39 0.5
40 0.44
41 0.41
42 0.35
43 0.28
44 0.25
45 0.23
46 0.22
47 0.2
48 0.21
49 0.18
50 0.19
51 0.19
52 0.18
53 0.18
54 0.17
55 0.18
56 0.19
57 0.22
58 0.21
59 0.2
60 0.19
61 0.18
62 0.16
63 0.15
64 0.11
65 0.11
66 0.14
67 0.18
68 0.19
69 0.22
70 0.24
71 0.25
72 0.27
73 0.24
74 0.21
75 0.18
76 0.17
77 0.13
78 0.11
79 0.09
80 0.08
81 0.1
82 0.09
83 0.08
84 0.08
85 0.09
86 0.1
87 0.11
88 0.12
89 0.16
90 0.18
91 0.23
92 0.27
93 0.27
94 0.26
95 0.25
96 0.24
97 0.19
98 0.17
99 0.12
100 0.12
101 0.13
102 0.18
103 0.23
104 0.28
105 0.31
106 0.36
107 0.39
108 0.44
109 0.45
110 0.47
111 0.51
112 0.49
113 0.47
114 0.45
115 0.41
116 0.34
117 0.3
118 0.25
119 0.19
120 0.2
121 0.19
122 0.16
123 0.17
124 0.17
125 0.2
126 0.2
127 0.17
128 0.18
129 0.22
130 0.29
131 0.36
132 0.39
133 0.42
134 0.5
135 0.57
136 0.63
137 0.65
138 0.66
139 0.64
140 0.7
141 0.73
142 0.69
143 0.61
144 0.54
145 0.49
146 0.43
147 0.41
148 0.31
149 0.26
150 0.23
151 0.23
152 0.24
153 0.29
154 0.33
155 0.4
156 0.48
157 0.55
158 0.65
159 0.74
160 0.79
161 0.84
162 0.86
163 0.86
164 0.88
165 0.85
166 0.83
167 0.81
168 0.81
169 0.8
170 0.8
171 0.78
172 0.69
173 0.64
174 0.65