Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8SWZ2

Protein Details
Accession A0A1V8SWZ2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRGPQGPKKREPLATBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSRGPQGPKKR
Subcellular Location(s) mito 15.5, cyto_mito 12.833, cyto 9, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRGPQGPKKREPLATTFKCVFCNSENSVSTKIDKKAGVASLTCKNCVANYQMSSTYLTQPVDVYFDWIDACEAVAQEGTATGTATSRPSQGRGLTQSRARGGLAPGEKVTAEDDGFIDDEGAEVDDFGDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.87
3 0.82
4 0.77
5 0.7
6 0.68
7 0.67
8 0.62
9 0.61
10 0.57
11 0.52
12 0.48
13 0.45
14 0.39
15 0.31
16 0.33
17 0.3
18 0.32
19 0.32
20 0.33
21 0.35
22 0.33
23 0.33
24 0.33
25 0.31
26 0.28
27 0.27
28 0.25
29 0.26
30 0.27
31 0.26
32 0.21
33 0.23
34 0.26
35 0.27
36 0.27
37 0.23
38 0.21
39 0.19
40 0.2
41 0.2
42 0.16
43 0.16
44 0.18
45 0.18
46 0.19
47 0.2
48 0.2
49 0.18
50 0.16
51 0.15
52 0.12
53 0.12
54 0.11
55 0.11
56 0.1
57 0.1
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.05
64 0.06
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.03
71 0.04
72 0.04
73 0.03
74 0.04
75 0.03
76 0.04
77 0.05
78 0.07
79 0.08
80 0.11
81 0.12
82 0.14
83 0.18
84 0.19
85 0.23
86 0.28
87 0.31
88 0.33
89 0.36
90 0.38
91 0.37
92 0.36
93 0.32
94 0.28
95 0.25
96 0.27
97 0.25
98 0.22
99 0.21
100 0.21
101 0.2
102 0.18
103 0.19
104 0.13
105 0.11
106 0.1
107 0.1
108 0.11
109 0.11
110 0.1
111 0.09
112 0.07
113 0.07
114 0.07
115 0.08
116 0.06
117 0.05
118 0.05