Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9NVU6

Protein Details
Accession G9NVU6    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
25-52IAVEDPPSKRKRKRKRKRPLGLNMCLASHydrophilic
NLS Segment(s)
PositionSequence
32-43SKRKRKRKRKRP
Subcellular Location(s) mito 21.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
Amino Acid Sequences MAVKLQAKRPGANKLANTTSSISLIAVEDPPSKRKRKRKRKRPLGLNMCLASPLRRKSVWPWITLHTPRAMCQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.45
4 0.43
5 0.36
6 0.31
7 0.25
8 0.22
9 0.16
10 0.12
11 0.12
12 0.1
13 0.08
14 0.09
15 0.11
16 0.13
17 0.18
18 0.24
19 0.31
20 0.39
21 0.5
22 0.59
23 0.68
24 0.78
25 0.83
26 0.89
27 0.93
28 0.94
29 0.94
30 0.94
31 0.93
32 0.87
33 0.81
34 0.7
35 0.59
36 0.49
37 0.39
38 0.32
39 0.28
40 0.26
41 0.24
42 0.24
43 0.27
44 0.32
45 0.43
46 0.43
47 0.4
48 0.41
49 0.42
50 0.5
51 0.51
52 0.49
53 0.45