Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NQT4

Protein Details
Accession G9NQT4    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
43-63VTGCRRCWRRLLKRQKLGMIQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 5, extr 4, plas 3, pero 3
Family & Domain DBs
Amino Acid Sequences MDVHGMAVQTFFVILFFLPRDIGRQLNVMQPTPEMDGGEWFIVTGCRRCWRRLLKRQKLGMIQELLDLDLATFSLVSRVFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.06
3 0.06
4 0.07
5 0.08
6 0.08
7 0.11
8 0.13
9 0.14
10 0.13
11 0.15
12 0.16
13 0.2
14 0.22
15 0.2
16 0.18
17 0.17
18 0.17
19 0.16
20 0.15
21 0.1
22 0.08
23 0.08
24 0.09
25 0.09
26 0.07
27 0.05
28 0.05
29 0.06
30 0.07
31 0.08
32 0.09
33 0.17
34 0.19
35 0.21
36 0.3
37 0.4
38 0.5
39 0.59
40 0.69
41 0.72
42 0.79
43 0.83
44 0.81
45 0.76
46 0.69
47 0.65
48 0.55
49 0.45
50 0.37
51 0.31
52 0.25
53 0.19
54 0.15
55 0.08
56 0.06
57 0.06
58 0.04
59 0.04
60 0.04
61 0.07