Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9P369

Protein Details
Accession G9P369    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-37GMKQLLEKKKRLSEKKRVLEKRQPFEKKKLSEKBasic
126-146KRQPFEKKRVLEKKQVVEKKQBasic
NLS Segment(s)
PositionSequence
12-135KKKRLSEKKRVLEKRQPFEKKKLSEKMQVLEKKQLFEKKKLSEKKLSEKKRVLEKQQLFEKQKLSEKKKFSEKKRVLEKKQLFEKKKLSEREQVLEKRQPFEKKKLSEREQVLEKRQPFEKKRV
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MERFGMKQLLEKKKRLSEKKRVLEKRQPFEKKKLSEKMQVLEKKQLFEKKKLSEKKLSEKKRVLEKQQLFEKQKLSEKKKFSEKKRVLEKKQLFEKKKLSEREQVLEKRQPFEKKKLSEREQVLEKRQPFEKKRVLEKKQVVEKKQVVETKQLLEMER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.78
3 0.79
4 0.79
5 0.83
6 0.87
7 0.9
8 0.9
9 0.9
10 0.89
11 0.89
12 0.88
13 0.87
14 0.87
15 0.83
16 0.83
17 0.83
18 0.8
19 0.8
20 0.79
21 0.75
22 0.73
23 0.71
24 0.67
25 0.67
26 0.65
27 0.59
28 0.58
29 0.54
30 0.47
31 0.48
32 0.51
33 0.46
34 0.48
35 0.53
36 0.52
37 0.6
38 0.66
39 0.67
40 0.67
41 0.69
42 0.73
43 0.75
44 0.75
45 0.74
46 0.72
47 0.71
48 0.72
49 0.72
50 0.68
51 0.68
52 0.65
53 0.62
54 0.64
55 0.66
56 0.59
57 0.56
58 0.52
59 0.44
60 0.47
61 0.49
62 0.49
63 0.48
64 0.49
65 0.51
66 0.59
67 0.64
68 0.64
69 0.67
70 0.66
71 0.68
72 0.74
73 0.79
74 0.74
75 0.76
76 0.75
77 0.72
78 0.75
79 0.75
80 0.69
81 0.67
82 0.7
83 0.67
84 0.68
85 0.67
86 0.62
87 0.61
88 0.6
89 0.57
90 0.58
91 0.54
92 0.53
93 0.53
94 0.5
95 0.45
96 0.48
97 0.52
98 0.5
99 0.56
100 0.59
101 0.59
102 0.67
103 0.73
104 0.74
105 0.72
106 0.7
107 0.64
108 0.63
109 0.61
110 0.57
111 0.54
112 0.5
113 0.45
114 0.48
115 0.52
116 0.49
117 0.54
118 0.57
119 0.57
120 0.67
121 0.74
122 0.75
123 0.76
124 0.79
125 0.78
126 0.8
127 0.82
128 0.75
129 0.74
130 0.73
131 0.68
132 0.67
133 0.63
134 0.55
135 0.55
136 0.54
137 0.47
138 0.46