Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V8TLZ3

Protein Details
Accession A0A1V8TLZ3    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
90-121TTPKTKAKAKAAKPKAVKKAKKATPPKKVYTEHydrophilic
NLS Segment(s)
PositionSequence
45-71KPGRPKKAVGEPSRVIKRAVKRVAKKP
92-142PKTKAKAKAAKPKAVKKAKKATPPKKVYTEAQLAAKKERAARAKAAKDVKS
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MLGRQVTFLLRRPQLPLRLATSSTQCLSAQSLHTTPAVLGVTASKPGRPKKAVGEPSRVIKRAVKRVAKKPASDPDDAASQQVAAKQAGTTPKTKAKAKAAKPKAVKKAKKATPPKKVYTEAQLAAKKERAARAKAAKDVKSLKAAALSPPKIVPSNAYLQFIKAHKGDLQSLVNAEKEKLSEGSKLNIKGTLTEHSKNLSAAWKEQSPADIEHFNHLAHTTTEAHQAAYKSWVQSHTPNEIKLANSARRSLRRRESSSSSGSEPAKNRRTRWPAILDEREPKAAVQPYIQFSIARNASGDFKHLPLIERSKLIGEEWKALEVGEKKKYETLHSADRERYIDEYSSVHGHAPLAQLESQHPELTSAASAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.53
3 0.51
4 0.47
5 0.47
6 0.47
7 0.45
8 0.42
9 0.39
10 0.35
11 0.33
12 0.27
13 0.25
14 0.26
15 0.25
16 0.23
17 0.23
18 0.23
19 0.23
20 0.23
21 0.22
22 0.19
23 0.2
24 0.17
25 0.12
26 0.12
27 0.12
28 0.13
29 0.18
30 0.19
31 0.18
32 0.25
33 0.32
34 0.41
35 0.42
36 0.45
37 0.49
38 0.59
39 0.66
40 0.66
41 0.67
42 0.62
43 0.68
44 0.71
45 0.63
46 0.55
47 0.52
48 0.54
49 0.55
50 0.61
51 0.62
52 0.64
53 0.72
54 0.8
55 0.79
56 0.75
57 0.72
58 0.73
59 0.69
60 0.62
61 0.54
62 0.45
63 0.43
64 0.4
65 0.32
66 0.22
67 0.17
68 0.16
69 0.16
70 0.16
71 0.11
72 0.11
73 0.11
74 0.14
75 0.2
76 0.22
77 0.22
78 0.25
79 0.32
80 0.38
81 0.43
82 0.46
83 0.5
84 0.58
85 0.64
86 0.7
87 0.71
88 0.74
89 0.78
90 0.8
91 0.8
92 0.81
93 0.79
94 0.77
95 0.8
96 0.78
97 0.8
98 0.83
99 0.82
100 0.82
101 0.83
102 0.8
103 0.76
104 0.72
105 0.65
106 0.61
107 0.56
108 0.48
109 0.47
110 0.44
111 0.39
112 0.38
113 0.37
114 0.32
115 0.3
116 0.34
117 0.33
118 0.33
119 0.39
120 0.44
121 0.46
122 0.5
123 0.54
124 0.49
125 0.49
126 0.5
127 0.45
128 0.41
129 0.37
130 0.31
131 0.27
132 0.26
133 0.25
134 0.28
135 0.27
136 0.24
137 0.24
138 0.25
139 0.22
140 0.22
141 0.18
142 0.14
143 0.19
144 0.2
145 0.22
146 0.21
147 0.21
148 0.25
149 0.24
150 0.24
151 0.17
152 0.17
153 0.16
154 0.18
155 0.19
156 0.18
157 0.18
158 0.15
159 0.16
160 0.15
161 0.14
162 0.13
163 0.12
164 0.09
165 0.08
166 0.09
167 0.1
168 0.1
169 0.13
170 0.14
171 0.17
172 0.2
173 0.21
174 0.21
175 0.21
176 0.19
177 0.17
178 0.18
179 0.2
180 0.2
181 0.21
182 0.21
183 0.2
184 0.21
185 0.19
186 0.19
187 0.19
188 0.15
189 0.17
190 0.19
191 0.18
192 0.18
193 0.18
194 0.18
195 0.15
196 0.15
197 0.15
198 0.16
199 0.15
200 0.17
201 0.18
202 0.17
203 0.15
204 0.14
205 0.12
206 0.1
207 0.12
208 0.11
209 0.11
210 0.16
211 0.16
212 0.16
213 0.17
214 0.17
215 0.16
216 0.17
217 0.18
218 0.14
219 0.16
220 0.18
221 0.18
222 0.23
223 0.26
224 0.3
225 0.31
226 0.31
227 0.31
228 0.3
229 0.28
230 0.28
231 0.3
232 0.27
233 0.27
234 0.31
235 0.35
236 0.43
237 0.47
238 0.51
239 0.55
240 0.59
241 0.63
242 0.65
243 0.66
244 0.63
245 0.63
246 0.57
247 0.49
248 0.45
249 0.41
250 0.4
251 0.38
252 0.42
253 0.46
254 0.48
255 0.49
256 0.55
257 0.61
258 0.6
259 0.63
260 0.6
261 0.59
262 0.63
263 0.66
264 0.6
265 0.59
266 0.56
267 0.5
268 0.43
269 0.35
270 0.32
271 0.29
272 0.26
273 0.23
274 0.26
275 0.27
276 0.29
277 0.3
278 0.24
279 0.22
280 0.29
281 0.26
282 0.22
283 0.2
284 0.18
285 0.21
286 0.21
287 0.24
288 0.17
289 0.17
290 0.21
291 0.21
292 0.22
293 0.25
294 0.31
295 0.3
296 0.3
297 0.3
298 0.28
299 0.28
300 0.27
301 0.27
302 0.23
303 0.26
304 0.26
305 0.26
306 0.24
307 0.23
308 0.27
309 0.27
310 0.31
311 0.33
312 0.33
313 0.34
314 0.38
315 0.4
316 0.4
317 0.41
318 0.41
319 0.43
320 0.48
321 0.52
322 0.52
323 0.54
324 0.5
325 0.44
326 0.4
327 0.33
328 0.28
329 0.24
330 0.22
331 0.21
332 0.22
333 0.21
334 0.2
335 0.17
336 0.16
337 0.18
338 0.19
339 0.18
340 0.18
341 0.18
342 0.19
343 0.2
344 0.26
345 0.25
346 0.24
347 0.22
348 0.21
349 0.2
350 0.21