Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TDB7

Protein Details
Accession A0A1V8TDB7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
57-89DSPVIRGKRNRPRVQKSIRQRKRKRAPSPEVASHydrophilic
NLS Segment(s)
PositionSequence
62-94RGKRNRPRVQKSIRQRKRKRAPSPEVASPKKPR
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPLQRSRDCPSPRASSSSRLALEIEDKEDKEAEDDEDYVDDGASEDDDDDEDDGDADSPVIRGKRNRPRVQKSIRQRKRKRAPSPEVASPKKPRTAPEILEDAIMIADNDDTPNQPAPPSPGRTLLSYPPPQGTNLTLAADFPRYDPQVPHIRVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.5
3 0.5
4 0.52
5 0.46
6 0.38
7 0.36
8 0.3
9 0.31
10 0.26
11 0.26
12 0.22
13 0.21
14 0.22
15 0.22
16 0.2
17 0.18
18 0.17
19 0.15
20 0.13
21 0.13
22 0.12
23 0.12
24 0.12
25 0.1
26 0.09
27 0.06
28 0.05
29 0.05
30 0.05
31 0.04
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.06
47 0.07
48 0.1
49 0.14
50 0.24
51 0.34
52 0.45
53 0.53
54 0.62
55 0.69
56 0.76
57 0.8
58 0.8
59 0.81
60 0.82
61 0.82
62 0.83
63 0.84
64 0.85
65 0.87
66 0.89
67 0.88
68 0.87
69 0.85
70 0.84
71 0.8
72 0.77
73 0.75
74 0.68
75 0.64
76 0.6
77 0.56
78 0.52
79 0.49
80 0.43
81 0.41
82 0.44
83 0.4
84 0.37
85 0.37
86 0.31
87 0.3
88 0.27
89 0.2
90 0.14
91 0.11
92 0.07
93 0.04
94 0.03
95 0.03
96 0.04
97 0.05
98 0.06
99 0.08
100 0.1
101 0.1
102 0.1
103 0.11
104 0.17
105 0.23
106 0.27
107 0.27
108 0.31
109 0.33
110 0.35
111 0.37
112 0.36
113 0.39
114 0.38
115 0.38
116 0.36
117 0.35
118 0.34
119 0.33
120 0.29
121 0.24
122 0.22
123 0.21
124 0.18
125 0.17
126 0.18
127 0.18
128 0.16
129 0.14
130 0.19
131 0.21
132 0.23
133 0.24
134 0.29
135 0.37