Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TFV1

Protein Details
Accession A0A1V8TFV1   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
55-75VPGLREKRRERRRSAEKEVRGBasic
79-104WGGSRRSGSRHRHHHQHHHDEYRRSVBasic
NLS Segment(s)
PositionSequence
59-91REKRRERRRSAEKEVRGSGSWGGSRRSGSRHRH
Subcellular Location(s) plas 23, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
PROSITE View protein in PROSITE  
PS01309  UPF0057  
Amino Acid Sequences MVLVSLAEGILAIFLPPLAVLLRTGCSLNFLLNILLTALAWVPGVIHAWVVILAVPGLREKRRERRRSAEKEVRGSGSWGGSRRSGSRHRHHHQHHHDEYRRSVSRQRGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.04
5 0.04
6 0.05
7 0.05
8 0.07
9 0.08
10 0.09
11 0.1
12 0.09
13 0.11
14 0.11
15 0.11
16 0.11
17 0.1
18 0.09
19 0.09
20 0.09
21 0.06
22 0.06
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.03
29 0.03
30 0.03
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.04
44 0.07
45 0.08
46 0.14
47 0.2
48 0.31
49 0.42
50 0.5
51 0.56
52 0.65
53 0.75
54 0.78
55 0.83
56 0.82
57 0.77
58 0.75
59 0.7
60 0.62
61 0.52
62 0.44
63 0.35
64 0.28
65 0.25
66 0.21
67 0.2
68 0.19
69 0.21
70 0.22
71 0.27
72 0.34
73 0.4
74 0.48
75 0.57
76 0.63
77 0.71
78 0.78
79 0.83
80 0.84
81 0.86
82 0.85
83 0.85
84 0.85
85 0.81
86 0.78
87 0.76
88 0.7
89 0.63
90 0.61