Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8SX38

Protein Details
Accession A0A1V8SX38    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
35-57LLTQRKEAKKVSKARYNPNDTPSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 4, golg 4, plas 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR047128  PhyH  
IPR008775  Phytyl_CoA_dOase-like  
Gene Ontology GO:0016020  C:membrane  
GO:0048244  F:phytanoyl-CoA dioxygenase activity  
GO:0001561  P:fatty acid alpha-oxidation  
Pfam View protein in Pfam  
PF05721  PhyH  
Amino Acid Sequences MAPTPLRQGVPTAIAAFATLAAVVGTLSYLDIPSLLTQRKEAKKVSKARYNPNDTPSLLAFKALVEQDTLPSTYPLASSIERNIPIYDARSLNLNDAKVVEEFQDEVFHILYHGPGVLVMKNFFRDLSLIDAANSAFTAIINREAEAKLSDPAYFGTTKYDKTPNAWISNSFSKLCLQDPETFLDYFSNPLFPVICSAYLGPQYKITAQVNAVRPGGKPQHLHRDYHLGFPSREDVAKFPKQMHELSRLLTMQGAVAHADMPAESGPTRFLPYSQGFGEGYMATGREEFKQYFAENYVSLPLEKGDALFFSPGLFHGAGENVSQDVDRIAHLFQVSCAMGKTMESIDTHPLIEATYDLLAGMQGKEGTEQQVDAFVQSVAEGYPFPSNPDKRKPVPGSKGPESEQQLLRRALSGKWEKAKLMEELTSMRVACQAST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.14
4 0.11
5 0.08
6 0.06
7 0.05
8 0.04
9 0.04
10 0.04
11 0.03
12 0.03
13 0.03
14 0.04
15 0.04
16 0.04
17 0.04
18 0.05
19 0.06
20 0.08
21 0.15
22 0.18
23 0.19
24 0.24
25 0.34
26 0.41
27 0.47
28 0.52
29 0.56
30 0.62
31 0.71
32 0.76
33 0.76
34 0.77
35 0.82
36 0.84
37 0.84
38 0.81
39 0.75
40 0.71
41 0.61
42 0.57
43 0.48
44 0.43
45 0.33
46 0.27
47 0.22
48 0.17
49 0.2
50 0.17
51 0.16
52 0.13
53 0.13
54 0.14
55 0.16
56 0.17
57 0.13
58 0.13
59 0.13
60 0.12
61 0.11
62 0.11
63 0.12
64 0.13
65 0.14
66 0.18
67 0.23
68 0.24
69 0.25
70 0.24
71 0.22
72 0.22
73 0.23
74 0.23
75 0.19
76 0.18
77 0.21
78 0.21
79 0.25
80 0.27
81 0.25
82 0.2
83 0.2
84 0.21
85 0.17
86 0.17
87 0.13
88 0.1
89 0.11
90 0.1
91 0.11
92 0.1
93 0.1
94 0.1
95 0.09
96 0.08
97 0.08
98 0.07
99 0.06
100 0.06
101 0.05
102 0.05
103 0.07
104 0.08
105 0.09
106 0.1
107 0.11
108 0.13
109 0.13
110 0.12
111 0.12
112 0.1
113 0.1
114 0.14
115 0.15
116 0.14
117 0.13
118 0.14
119 0.13
120 0.13
121 0.11
122 0.06
123 0.04
124 0.04
125 0.05
126 0.05
127 0.09
128 0.1
129 0.1
130 0.12
131 0.12
132 0.13
133 0.13
134 0.13
135 0.11
136 0.11
137 0.11
138 0.1
139 0.1
140 0.12
141 0.11
142 0.1
143 0.15
144 0.16
145 0.17
146 0.21
147 0.25
148 0.24
149 0.26
150 0.34
151 0.34
152 0.36
153 0.36
154 0.33
155 0.33
156 0.37
157 0.37
158 0.29
159 0.24
160 0.23
161 0.23
162 0.23
163 0.2
164 0.19
165 0.2
166 0.21
167 0.24
168 0.24
169 0.23
170 0.21
171 0.2
172 0.17
173 0.14
174 0.13
175 0.1
176 0.08
177 0.08
178 0.08
179 0.07
180 0.09
181 0.08
182 0.08
183 0.08
184 0.08
185 0.09
186 0.14
187 0.15
188 0.14
189 0.14
190 0.14
191 0.14
192 0.19
193 0.18
194 0.14
195 0.15
196 0.2
197 0.22
198 0.24
199 0.24
200 0.21
201 0.2
202 0.24
203 0.26
204 0.23
205 0.23
206 0.25
207 0.35
208 0.36
209 0.37
210 0.34
211 0.4
212 0.37
213 0.4
214 0.39
215 0.31
216 0.29
217 0.29
218 0.3
219 0.21
220 0.2
221 0.16
222 0.15
223 0.19
224 0.23
225 0.23
226 0.23
227 0.26
228 0.28
229 0.3
230 0.31
231 0.3
232 0.27
233 0.27
234 0.28
235 0.24
236 0.22
237 0.19
238 0.16
239 0.09
240 0.09
241 0.08
242 0.05
243 0.05
244 0.06
245 0.05
246 0.05
247 0.04
248 0.04
249 0.04
250 0.05
251 0.05
252 0.05
253 0.06
254 0.07
255 0.09
256 0.09
257 0.09
258 0.14
259 0.16
260 0.19
261 0.18
262 0.19
263 0.17
264 0.17
265 0.18
266 0.12
267 0.11
268 0.08
269 0.08
270 0.06
271 0.07
272 0.08
273 0.09
274 0.12
275 0.12
276 0.13
277 0.15
278 0.16
279 0.16
280 0.18
281 0.17
282 0.14
283 0.15
284 0.15
285 0.13
286 0.13
287 0.11
288 0.09
289 0.09
290 0.09
291 0.08
292 0.07
293 0.07
294 0.07
295 0.07
296 0.07
297 0.06
298 0.07
299 0.07
300 0.09
301 0.09
302 0.08
303 0.08
304 0.09
305 0.1
306 0.1
307 0.1
308 0.07
309 0.07
310 0.07
311 0.06
312 0.06
313 0.06
314 0.06
315 0.07
316 0.07
317 0.09
318 0.1
319 0.1
320 0.09
321 0.12
322 0.12
323 0.11
324 0.11
325 0.1
326 0.1
327 0.1
328 0.12
329 0.09
330 0.11
331 0.11
332 0.13
333 0.16
334 0.17
335 0.17
336 0.15
337 0.15
338 0.13
339 0.12
340 0.1
341 0.07
342 0.06
343 0.06
344 0.06
345 0.06
346 0.06
347 0.07
348 0.07
349 0.07
350 0.07
351 0.07
352 0.09
353 0.1
354 0.13
355 0.12
356 0.12
357 0.11
358 0.15
359 0.15
360 0.13
361 0.13
362 0.1
363 0.09
364 0.09
365 0.09
366 0.06
367 0.06
368 0.06
369 0.07
370 0.11
371 0.11
372 0.16
373 0.25
374 0.32
375 0.39
376 0.49
377 0.56
378 0.57
379 0.68
380 0.73
381 0.74
382 0.77
383 0.78
384 0.77
385 0.76
386 0.77
387 0.69
388 0.68
389 0.64
390 0.62
391 0.59
392 0.55
393 0.54
394 0.51
395 0.48
396 0.44
397 0.4
398 0.34
399 0.38
400 0.42
401 0.43
402 0.49
403 0.52
404 0.49
405 0.52
406 0.54
407 0.48
408 0.43
409 0.37
410 0.31
411 0.31
412 0.31
413 0.3
414 0.26
415 0.22
416 0.22