Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V8T3I3

Protein Details
Accession A0A1V8T3I3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAATGGKKQKKKWSKGKVKDKAVHAVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 18, mito 9, cyto_nucl 9, cyto_pero 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKAVHAVTLDKATGEKLAKDVQSYRLVTVAVLVDRLKINGSLARQALKDLEEKGTIKKIVGHSSGNIYTRAVGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.88
9 0.82
10 0.8
11 0.7
12 0.61
13 0.51
14 0.44
15 0.34
16 0.29
17 0.24
18 0.15
19 0.13
20 0.11
21 0.13
22 0.11
23 0.1
24 0.11
25 0.14
26 0.14
27 0.15
28 0.17
29 0.18
30 0.23
31 0.23
32 0.21
33 0.19
34 0.18
35 0.16
36 0.16
37 0.12
38 0.06
39 0.07
40 0.06
41 0.07
42 0.07
43 0.08
44 0.07
45 0.07
46 0.08
47 0.09
48 0.11
49 0.13
50 0.14
51 0.16
52 0.16
53 0.16
54 0.17
55 0.15
56 0.17
57 0.15
58 0.16
59 0.17
60 0.19
61 0.21
62 0.25
63 0.24
64 0.22
65 0.26
66 0.28
67 0.31
68 0.33
69 0.32
70 0.29
71 0.35
72 0.38
73 0.35
74 0.31
75 0.26
76 0.23