Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8T0B1

Protein Details
Accession A0A1V8T0B1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
372-396QWTRGMCVIDRRSRKKREVDLEEDIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, extr 7, cyto_nucl 5.5, mito 3, E.R. 3, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001910  Inosine/uridine_hydrolase_dom  
IPR023186  IUNH  
IPR036452  Ribo_hydro-like  
Gene Ontology GO:0016799  F:hydrolase activity, hydrolyzing N-glycosyl compounds  
GO:0006139  P:nucleobase-containing compound metabolic process  
GO:1901564  P:organonitrogen compound metabolic process  
Pfam View protein in Pfam  
PF01156  IU_nuc_hydro  
Amino Acid Sequences MAPRKVIIDTDPGCDDTLAMLLAFAASPEDLEVLMVSATYGNVELESCLRNVVSLFYHIEKEIEWRKANGRKVGFETLLKTKPIVSVGPEHPLLDTKLMADYFHGNDGLGGISDSHPHLSPADTWKELFDITKAPKDPEIDELRKELESPALFTPSQVPAHLEILRLLRENEPNTITIVAVGPLTNLAIAAAEDAETFLRVKEVVVMGGNLYEVTPVAEFNTFADTVAAARVYALTSPSPHSTMPPVPPTPAGRQTDHAPPPYLQPYPAKLSKQLNVTLFPLDITQQHEISRGEFQSHTAPLISAGSPLAEWVSAWLNSTFHKVESLQDDVTGDAVGLHLHDPMTIWYCITQLDPKWELVRDEDIRVETSGQWTRGMCVIDRRSRKKREVDLEEDISSDHGAWLSAKAGNRLSRCVGSPGTGIFGTYLLEKIFAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.15
4 0.14
5 0.1
6 0.08
7 0.07
8 0.06
9 0.06
10 0.05
11 0.05
12 0.05
13 0.04
14 0.05
15 0.05
16 0.06
17 0.05
18 0.06
19 0.06
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.06
31 0.07
32 0.09
33 0.11
34 0.1
35 0.11
36 0.11
37 0.11
38 0.11
39 0.12
40 0.11
41 0.13
42 0.16
43 0.18
44 0.2
45 0.19
46 0.19
47 0.17
48 0.24
49 0.28
50 0.32
51 0.32
52 0.34
53 0.42
54 0.49
55 0.56
56 0.56
57 0.53
58 0.51
59 0.54
60 0.57
61 0.51
62 0.46
63 0.43
64 0.42
65 0.42
66 0.37
67 0.32
68 0.28
69 0.27
70 0.27
71 0.24
72 0.19
73 0.23
74 0.24
75 0.29
76 0.28
77 0.26
78 0.24
79 0.25
80 0.23
81 0.17
82 0.15
83 0.11
84 0.13
85 0.13
86 0.12
87 0.12
88 0.14
89 0.14
90 0.15
91 0.14
92 0.12
93 0.11
94 0.12
95 0.1
96 0.07
97 0.06
98 0.05
99 0.06
100 0.07
101 0.08
102 0.09
103 0.09
104 0.1
105 0.1
106 0.11
107 0.13
108 0.18
109 0.22
110 0.21
111 0.21
112 0.21
113 0.21
114 0.21
115 0.18
116 0.13
117 0.15
118 0.17
119 0.23
120 0.24
121 0.24
122 0.27
123 0.28
124 0.28
125 0.29
126 0.35
127 0.32
128 0.32
129 0.32
130 0.31
131 0.29
132 0.28
133 0.21
134 0.18
135 0.15
136 0.17
137 0.16
138 0.18
139 0.17
140 0.17
141 0.19
142 0.18
143 0.18
144 0.16
145 0.16
146 0.15
147 0.18
148 0.19
149 0.16
150 0.15
151 0.16
152 0.17
153 0.16
154 0.15
155 0.15
156 0.19
157 0.2
158 0.2
159 0.2
160 0.19
161 0.19
162 0.18
163 0.14
164 0.11
165 0.1
166 0.07
167 0.06
168 0.06
169 0.05
170 0.04
171 0.04
172 0.04
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.06
190 0.06
191 0.06
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.04
198 0.04
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.04
205 0.04
206 0.05
207 0.05
208 0.07
209 0.07
210 0.07
211 0.07
212 0.06
213 0.06
214 0.06
215 0.06
216 0.04
217 0.03
218 0.04
219 0.04
220 0.04
221 0.05
222 0.05
223 0.06
224 0.09
225 0.1
226 0.12
227 0.11
228 0.12
229 0.15
230 0.18
231 0.21
232 0.23
233 0.22
234 0.22
235 0.24
236 0.27
237 0.28
238 0.32
239 0.31
240 0.28
241 0.3
242 0.32
243 0.38
244 0.39
245 0.36
246 0.31
247 0.28
248 0.3
249 0.32
250 0.29
251 0.23
252 0.22
253 0.23
254 0.27
255 0.31
256 0.28
257 0.3
258 0.34
259 0.36
260 0.37
261 0.39
262 0.35
263 0.32
264 0.32
265 0.27
266 0.23
267 0.19
268 0.15
269 0.11
270 0.11
271 0.13
272 0.14
273 0.14
274 0.14
275 0.17
276 0.17
277 0.18
278 0.2
279 0.17
280 0.17
281 0.16
282 0.18
283 0.19
284 0.19
285 0.18
286 0.14
287 0.14
288 0.12
289 0.13
290 0.12
291 0.08
292 0.08
293 0.07
294 0.07
295 0.07
296 0.06
297 0.04
298 0.04
299 0.05
300 0.08
301 0.08
302 0.09
303 0.1
304 0.11
305 0.12
306 0.17
307 0.16
308 0.14
309 0.16
310 0.15
311 0.18
312 0.21
313 0.23
314 0.19
315 0.19
316 0.19
317 0.16
318 0.16
319 0.12
320 0.09
321 0.05
322 0.05
323 0.04
324 0.05
325 0.05
326 0.05
327 0.05
328 0.05
329 0.06
330 0.08
331 0.12
332 0.11
333 0.11
334 0.11
335 0.11
336 0.12
337 0.13
338 0.17
339 0.15
340 0.22
341 0.24
342 0.25
343 0.28
344 0.29
345 0.29
346 0.27
347 0.33
348 0.28
349 0.29
350 0.29
351 0.28
352 0.27
353 0.27
354 0.25
355 0.18
356 0.22
357 0.25
358 0.24
359 0.25
360 0.23
361 0.24
362 0.27
363 0.27
364 0.22
365 0.27
366 0.35
367 0.41
368 0.51
369 0.59
370 0.66
371 0.73
372 0.8
373 0.81
374 0.83
375 0.84
376 0.83
377 0.81
378 0.79
379 0.74
380 0.65
381 0.56
382 0.46
383 0.36
384 0.27
385 0.2
386 0.12
387 0.08
388 0.08
389 0.08
390 0.09
391 0.1
392 0.14
393 0.15
394 0.19
395 0.25
396 0.31
397 0.32
398 0.36
399 0.38
400 0.37
401 0.38
402 0.39
403 0.35
404 0.31
405 0.3
406 0.26
407 0.26
408 0.23
409 0.21
410 0.16
411 0.15
412 0.13
413 0.12
414 0.12
415 0.09