Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8S867

Protein Details
Accession A0A1V8S867   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
135-161RNFPRMTNTTARKERKKDKPMAVEPSPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 7, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022198  DUF3723  
Pfam View protein in Pfam  
PF12520  DUF3723  
Amino Acid Sequences MHTLAPRWSSPDAQQIKRLVNDSCFFPDLSRDTVRNTVLPNIKGVGTAIPNFFTFFEDIKYLEPCARFMRSLLPSSTTNARNGLSIQLGLKRHYFPSTDFEFAVDYAQGNMRSHRAAEFEEFTLKYQQLWLFALRNFPRMTNTTARKERKKDKPMAVEPSPIIWRELG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.49
4 0.5
5 0.49
6 0.42
7 0.39
8 0.38
9 0.35
10 0.35
11 0.31
12 0.28
13 0.25
14 0.27
15 0.24
16 0.27
17 0.27
18 0.23
19 0.26
20 0.3
21 0.31
22 0.28
23 0.27
24 0.29
25 0.32
26 0.31
27 0.29
28 0.26
29 0.24
30 0.22
31 0.21
32 0.16
33 0.12
34 0.14
35 0.13
36 0.13
37 0.13
38 0.14
39 0.14
40 0.13
41 0.12
42 0.11
43 0.12
44 0.11
45 0.12
46 0.12
47 0.13
48 0.12
49 0.13
50 0.13
51 0.14
52 0.16
53 0.17
54 0.16
55 0.15
56 0.21
57 0.21
58 0.23
59 0.22
60 0.22
61 0.21
62 0.23
63 0.28
64 0.23
65 0.21
66 0.2
67 0.2
68 0.17
69 0.17
70 0.15
71 0.1
72 0.09
73 0.09
74 0.11
75 0.12
76 0.13
77 0.14
78 0.14
79 0.15
80 0.17
81 0.17
82 0.15
83 0.19
84 0.21
85 0.21
86 0.2
87 0.19
88 0.18
89 0.17
90 0.16
91 0.1
92 0.07
93 0.06
94 0.08
95 0.1
96 0.1
97 0.11
98 0.12
99 0.12
100 0.13
101 0.14
102 0.13
103 0.14
104 0.16
105 0.17
106 0.17
107 0.2
108 0.19
109 0.2
110 0.21
111 0.19
112 0.16
113 0.18
114 0.18
115 0.17
116 0.18
117 0.19
118 0.19
119 0.2
120 0.29
121 0.27
122 0.3
123 0.29
124 0.28
125 0.3
126 0.3
127 0.34
128 0.35
129 0.41
130 0.46
131 0.55
132 0.64
133 0.69
134 0.76
135 0.8
136 0.82
137 0.85
138 0.85
139 0.85
140 0.87
141 0.86
142 0.85
143 0.78
144 0.72
145 0.63
146 0.58
147 0.51
148 0.41