FuNGI

A0A1V8SZC8

Protein Details

Accession

A0A1V8SZC8

Localization Confidence

High

Confidence Score

15.7

NoLS Segment(s)

Position	Sequence	Protein Nature
31-53	LSGRLHHVPRRPHDRERQHLIKS	Basic
91-116	EKPFPPGEKKRAMKRKRTSLPGDPYP	Basic

NLS Segment(s)

Position	Sequence
95-107	PPGEKKRAMKRKR

Subcellular Location(s)

nucl 21.5, cyto_nucl 13, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR018608 Gti1/Pac2
Pfam	View protein in Pfam PF09729 Gti1_Pac2

Amino Acid Sequences

MSSGSAGPLVPTFHGFVHNSMDGLTLFEACLSGRLHHVPRRPHDRERQHLIKSGSIFIYEENASGIKRWTDGVAWSPSRILGNFLIYRELEKPFPPGEKKRAMKRKRTSLPGDPYPRRESDETDKSVISNKPRTPPTPAIGNDTKTDGAGSEQDKELERALIGSLVDSYGFRPDGLVKKTMSISVNGISHHMVSYYSVDDVKNNNLPRPSSDARLATLQVRPELYLKQNFRAPIEENEHYAVPNQMHAHPQMMQSTMQPNAYDVRQGQYYGGMYPTSYANGTGMYGAQAGQTWPTQQAAPASNMSYGAQQSYAPPQQAYSGYYKPSTQPPTSLKMETSYPGSQSQSYSTSYASSYPGQQPQQTPQHATQHQQTPQHQQTPQQQQHHQHQAPQQSPSSYGSMSGSISQQVYNPAHTQPYSAQQYPVRPVSIPQGGNGNYPQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.2
2	0.2
3	0.21
4	0.25
5	0.25
6	0.23
7	0.21
8	0.22
9	0.16
10	0.17
11	0.15
12	0.09
13	0.09
14	0.09
15	0.09
16	0.07
17	0.11
18	0.11
19	0.11
20	0.15
21	0.22
22	0.29
23	0.35
24	0.43
25	0.48
26	0.57
27	0.66
28	0.7
29	0.73
30	0.77
31	0.81
32	0.83
33	0.84
34	0.82
35	0.76
36	0.76
37	0.69
38	0.63
39	0.55
40	0.49
41	0.4
42	0.32
43	0.28
44	0.21
45	0.22
46	0.17
47	0.15
48	0.12
49	0.13
50	0.12
51	0.13
52	0.14
53	0.11
54	0.12
55	0.13
56	0.13
57	0.13
58	0.16
59	0.2
60	0.26
61	0.26
62	0.26
63	0.25
64	0.25
65	0.26
66	0.24
67	0.21
68	0.15
69	0.2
70	0.21
71	0.21
72	0.23
73	0.21
74	0.23
75	0.23
76	0.23
77	0.2
78	0.19
79	0.22
80	0.22
81	0.29
82	0.35
83	0.4
84	0.46
85	0.54
86	0.6
87	0.66
88	0.74
89	0.77
90	0.8
91	0.82
92	0.85
93	0.84
94	0.86
95	0.82
96	0.81
97	0.81
98	0.79
99	0.79
100	0.74
101	0.71
102	0.67
103	0.61
104	0.56
105	0.49
106	0.46
107	0.45
108	0.48
109	0.45
110	0.43
111	0.41
112	0.36
113	0.41
114	0.38
115	0.37
116	0.36
117	0.37
118	0.42
119	0.47
120	0.49
121	0.51
122	0.52
123	0.48
124	0.48
125	0.45
126	0.45
127	0.44
128	0.44
129	0.36
130	0.33
131	0.3
132	0.22
133	0.2
134	0.13
135	0.11
136	0.13
137	0.13
138	0.13
139	0.13
140	0.14
141	0.15
142	0.16
143	0.15
144	0.12
145	0.1
146	0.09
147	0.08
148	0.08
149	0.07
150	0.06
151	0.06
152	0.05
153	0.05
154	0.05
155	0.06
156	0.06
157	0.07
158	0.06
159	0.07
160	0.11
161	0.17
162	0.19
163	0.21
164	0.2
165	0.22
166	0.22
167	0.25
168	0.22
169	0.17
170	0.16
171	0.16
172	0.17
173	0.15
174	0.16
175	0.13
176	0.12
177	0.11
178	0.1
179	0.07
180	0.06
181	0.08
182	0.07
183	0.07
184	0.08
185	0.08
186	0.1
187	0.11
188	0.14
189	0.17
190	0.18
191	0.2
192	0.21
193	0.21
194	0.21
195	0.28
196	0.26
197	0.24
198	0.26
199	0.25
200	0.24
201	0.25
202	0.24
203	0.18
204	0.18
205	0.16
206	0.14
207	0.13
208	0.13
209	0.13
210	0.15
211	0.16
212	0.21
213	0.22
214	0.24
215	0.26
216	0.26
217	0.26
218	0.26
219	0.25
220	0.23
221	0.27
222	0.25
223	0.24
224	0.25
225	0.24
226	0.21
227	0.19
228	0.16
229	0.1
230	0.11
231	0.12
232	0.11
233	0.13
234	0.14
235	0.15
236	0.15
237	0.16
238	0.15
239	0.15
240	0.14
241	0.14
242	0.15
243	0.15
244	0.14
245	0.13
246	0.12
247	0.13
248	0.13
249	0.13
250	0.11
251	0.12
252	0.12
253	0.12
254	0.12
255	0.12
256	0.12
257	0.1
258	0.11
259	0.08
260	0.08
261	0.08
262	0.09
263	0.08
264	0.07
265	0.07
266	0.06
267	0.07
268	0.07
269	0.06
270	0.06
271	0.05
272	0.05
273	0.05
274	0.05
275	0.05
276	0.05
277	0.06
278	0.07
279	0.07
280	0.08
281	0.09
282	0.09
283	0.1
284	0.14
285	0.14
286	0.16
287	0.16
288	0.16
289	0.16
290	0.16
291	0.16
292	0.14
293	0.12
294	0.1
295	0.1
296	0.09
297	0.1
298	0.16
299	0.18
300	0.18
301	0.17
302	0.17
303	0.19
304	0.2
305	0.22
306	0.21
307	0.21
308	0.22
309	0.23
310	0.24
311	0.24
312	0.31
313	0.35
314	0.31
315	0.35
316	0.37
317	0.42
318	0.45
319	0.44
320	0.36
321	0.32
322	0.32
323	0.27
324	0.29
325	0.24
326	0.22
327	0.23
328	0.24
329	0.24
330	0.23
331	0.24
332	0.21
333	0.22
334	0.21
335	0.18
336	0.18
337	0.17
338	0.17
339	0.17
340	0.16
341	0.19
342	0.24
343	0.3
344	0.32
345	0.35
346	0.37
347	0.43
348	0.5
349	0.49
350	0.49
351	0.48
352	0.54
353	0.53
354	0.54
355	0.54
356	0.53
357	0.55
358	0.58
359	0.57
360	0.57
361	0.62
362	0.65
363	0.59
364	0.58
365	0.63
366	0.66
367	0.7
368	0.68
369	0.68
370	0.68
371	0.77
372	0.8
373	0.72
374	0.68
375	0.65
376	0.67
377	0.63
378	0.6
379	0.53
380	0.44
381	0.44
382	0.4
383	0.37
384	0.27
385	0.25
386	0.21
387	0.19
388	0.19
389	0.18
390	0.16
391	0.16
392	0.17
393	0.16
394	0.16
395	0.22
396	0.23
397	0.25
398	0.26
399	0.25
400	0.29
401	0.29
402	0.31
403	0.26
404	0.34
405	0.38
406	0.37
407	0.41
408	0.41
409	0.46
410	0.51
411	0.52
412	0.44
413	0.37
414	0.37
415	0.4
416	0.44
417	0.38
418	0.32
419	0.36
420	0.35

A0A1V8SZC8

3D AlphaFold-predicted Structure Viewer