Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TT65

Protein Details
Accession A0A1V8TT65   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
29-57LDDQRSKVTKPKRFRRPQQRKRCLLLNKLHydrophilic
NLS Segment(s)
PositionSequence
37-49TKPKRFRRPQQRK
Subcellular Location(s) mito 20.5, cyto_mito 12, nucl 4
Family & Domain DBs
Amino Acid Sequences MAPRKAPETQPTRRSGRIEAAKVIQQAILDDQRSKVTKPKRFRRPQQRKRCLLLNKLPGEIRNMIWHYAVVQNPITVTSSGPGEPGLLRASRQIRRETRAMYYSANEFIVEVMDYDGAALTPWSRQHYRYANAESCCKILMLGEPDWGNLMRWCKDVAQTPCALIPALEQKKPKCDCGQHNHYPDDDVAEGMIRIADELRWNLGWASVEKVLEGAHQAVTARNRDWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.61
3 0.61
4 0.61
5 0.56
6 0.54
7 0.51
8 0.5
9 0.47
10 0.43
11 0.34
12 0.24
13 0.22
14 0.21
15 0.22
16 0.19
17 0.2
18 0.2
19 0.25
20 0.27
21 0.27
22 0.31
23 0.37
24 0.45
25 0.54
26 0.64
27 0.69
28 0.78
29 0.88
30 0.91
31 0.92
32 0.94
33 0.95
34 0.95
35 0.92
36 0.87
37 0.85
38 0.81
39 0.8
40 0.78
41 0.76
42 0.67
43 0.62
44 0.57
45 0.49
46 0.45
47 0.38
48 0.29
49 0.26
50 0.25
51 0.23
52 0.21
53 0.2
54 0.18
55 0.2
56 0.2
57 0.16
58 0.15
59 0.14
60 0.13
61 0.14
62 0.14
63 0.1
64 0.09
65 0.08
66 0.09
67 0.08
68 0.09
69 0.08
70 0.07
71 0.07
72 0.08
73 0.09
74 0.08
75 0.08
76 0.13
77 0.2
78 0.24
79 0.28
80 0.34
81 0.37
82 0.41
83 0.45
84 0.42
85 0.39
86 0.37
87 0.35
88 0.28
89 0.25
90 0.22
91 0.19
92 0.17
93 0.13
94 0.1
95 0.08
96 0.07
97 0.06
98 0.05
99 0.04
100 0.04
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.04
109 0.06
110 0.1
111 0.12
112 0.13
113 0.2
114 0.26
115 0.29
116 0.33
117 0.38
118 0.39
119 0.4
120 0.42
121 0.36
122 0.31
123 0.27
124 0.22
125 0.15
126 0.11
127 0.12
128 0.13
129 0.12
130 0.14
131 0.14
132 0.14
133 0.15
134 0.14
135 0.12
136 0.11
137 0.14
138 0.13
139 0.14
140 0.16
141 0.16
142 0.19
143 0.26
144 0.28
145 0.28
146 0.27
147 0.27
148 0.26
149 0.26
150 0.22
151 0.14
152 0.12
153 0.19
154 0.22
155 0.25
156 0.3
157 0.32
158 0.41
159 0.44
160 0.47
161 0.44
162 0.49
163 0.55
164 0.61
165 0.68
166 0.68
167 0.71
168 0.68
169 0.61
170 0.54
171 0.44
172 0.38
173 0.28
174 0.19
175 0.13
176 0.11
177 0.11
178 0.09
179 0.09
180 0.05
181 0.05
182 0.05
183 0.06
184 0.09
185 0.1
186 0.13
187 0.13
188 0.14
189 0.14
190 0.15
191 0.17
192 0.15
193 0.18
194 0.18
195 0.18
196 0.17
197 0.17
198 0.15
199 0.14
200 0.15
201 0.12
202 0.1
203 0.11
204 0.11
205 0.16
206 0.21
207 0.24