Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TD80

Protein Details
Accession A0A1V8TD80    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-88GREGTPKPTFKKRTKGVKKAVLSFGHydrophilic
NLS Segment(s)
PositionSequence
73-80FKKRTKGV
Subcellular Location(s) cyto 12.5, cyto_nucl 12, nucl 8.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007005  XAP5  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04921  XAP5  
Amino Acid Sequences MADPDPSPSIHSARFTAQAHAVEDTLKEQTVGLVHLSDFRKRRAEALEHSQDGSGTSGATTPEGREGTPKPTFKKRTKGVKKAVLSFGDDEDGDEGGHAKAETIAATAKSGNTDLDAPSATTSGSELDTTILKRRLKANATAPFIAKAQTKASLAKEAALKDTLRKEYIQLQEAVKATEFVLPFVFYEGKDIPGGKVRLKKGDFIWLFLEKARKLGAELAETGKGPGGAGGRRSEWARISVDDLIIVRGEMIVPHHLDFHHFIVNAAVGYHGPLFPYSADVTRSTPARDLSRADSTSLPAGLTTADELHAVPAIPDADLEGFSDDPALTKVIDRRWYEKNKHIYPMSVWEEYDASRDYSKGGRKDQEGNAFFFSSNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.34
4 0.34
5 0.34
6 0.33
7 0.31
8 0.28
9 0.22
10 0.22
11 0.2
12 0.17
13 0.14
14 0.12
15 0.11
16 0.12
17 0.12
18 0.13
19 0.11
20 0.1
21 0.11
22 0.18
23 0.2
24 0.26
25 0.29
26 0.33
27 0.38
28 0.38
29 0.43
30 0.44
31 0.49
32 0.49
33 0.55
34 0.58
35 0.53
36 0.53
37 0.48
38 0.41
39 0.34
40 0.28
41 0.18
42 0.1
43 0.08
44 0.09
45 0.09
46 0.1
47 0.1
48 0.1
49 0.15
50 0.15
51 0.15
52 0.19
53 0.21
54 0.27
55 0.34
56 0.39
57 0.4
58 0.5
59 0.59
60 0.62
61 0.7
62 0.72
63 0.76
64 0.82
65 0.86
66 0.86
67 0.86
68 0.84
69 0.8
70 0.77
71 0.68
72 0.6
73 0.51
74 0.41
75 0.33
76 0.27
77 0.2
78 0.15
79 0.13
80 0.09
81 0.08
82 0.08
83 0.06
84 0.07
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.08
92 0.07
93 0.08
94 0.09
95 0.08
96 0.09
97 0.1
98 0.09
99 0.09
100 0.1
101 0.09
102 0.1
103 0.1
104 0.09
105 0.09
106 0.09
107 0.08
108 0.07
109 0.07
110 0.06
111 0.06
112 0.06
113 0.06
114 0.07
115 0.09
116 0.1
117 0.15
118 0.21
119 0.21
120 0.24
121 0.29
122 0.35
123 0.36
124 0.41
125 0.44
126 0.46
127 0.49
128 0.48
129 0.44
130 0.38
131 0.35
132 0.31
133 0.23
134 0.17
135 0.14
136 0.15
137 0.16
138 0.18
139 0.19
140 0.21
141 0.2
142 0.21
143 0.22
144 0.2
145 0.21
146 0.19
147 0.18
148 0.17
149 0.22
150 0.21
151 0.2
152 0.19
153 0.2
154 0.25
155 0.29
156 0.28
157 0.26
158 0.24
159 0.27
160 0.27
161 0.25
162 0.18
163 0.14
164 0.12
165 0.13
166 0.13
167 0.09
168 0.09
169 0.09
170 0.09
171 0.1
172 0.1
173 0.06
174 0.09
175 0.09
176 0.1
177 0.1
178 0.11
179 0.1
180 0.15
181 0.17
182 0.18
183 0.23
184 0.24
185 0.31
186 0.32
187 0.34
188 0.3
189 0.38
190 0.34
191 0.3
192 0.32
193 0.25
194 0.25
195 0.24
196 0.27
197 0.17
198 0.18
199 0.16
200 0.13
201 0.13
202 0.16
203 0.15
204 0.13
205 0.14
206 0.14
207 0.15
208 0.15
209 0.14
210 0.11
211 0.09
212 0.07
213 0.08
214 0.08
215 0.08
216 0.1
217 0.12
218 0.12
219 0.14
220 0.15
221 0.16
222 0.15
223 0.17
224 0.17
225 0.16
226 0.18
227 0.17
228 0.16
229 0.15
230 0.14
231 0.11
232 0.1
233 0.09
234 0.06
235 0.05
236 0.05
237 0.04
238 0.05
239 0.07
240 0.08
241 0.09
242 0.1
243 0.1
244 0.13
245 0.15
246 0.16
247 0.17
248 0.16
249 0.16
250 0.15
251 0.16
252 0.13
253 0.11
254 0.09
255 0.05
256 0.06
257 0.07
258 0.06
259 0.06
260 0.06
261 0.07
262 0.07
263 0.09
264 0.1
265 0.11
266 0.13
267 0.14
268 0.16
269 0.18
270 0.2
271 0.19
272 0.2
273 0.23
274 0.24
275 0.25
276 0.26
277 0.29
278 0.34
279 0.33
280 0.33
281 0.3
282 0.28
283 0.27
284 0.24
285 0.19
286 0.12
287 0.11
288 0.09
289 0.09
290 0.08
291 0.07
292 0.06
293 0.07
294 0.07
295 0.08
296 0.08
297 0.07
298 0.07
299 0.08
300 0.08
301 0.07
302 0.07
303 0.07
304 0.07
305 0.08
306 0.08
307 0.08
308 0.08
309 0.08
310 0.09
311 0.08
312 0.08
313 0.09
314 0.09
315 0.08
316 0.11
317 0.17
318 0.22
319 0.3
320 0.33
321 0.38
322 0.47
323 0.57
324 0.61
325 0.65
326 0.69
327 0.67
328 0.72
329 0.69
330 0.62
331 0.56
332 0.57
333 0.54
334 0.45
335 0.39
336 0.33
337 0.32
338 0.29
339 0.29
340 0.21
341 0.18
342 0.17
343 0.17
344 0.18
345 0.24
346 0.31
347 0.35
348 0.42
349 0.47
350 0.51
351 0.59
352 0.64
353 0.68
354 0.63
355 0.59
356 0.54
357 0.49