Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8UJ30

Protein Details
Accession A0A1V8UJ30    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
71-92LSVVMIRSNRKKARKARAKKASHydrophilic
NLS Segment(s)
PositionSequence
79-92NRKKARKARAKKAS
Subcellular Location(s) plas 20, E.R. 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MGAGKPLDRLVGLAMLIVSSTVFAYYTVWTLLMRFVDDSHFFHSLFPLRVWAIRIPVILLLLGGAVVGSFLSVVMIRSNRKKARKARAKKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.06
4 0.06
5 0.04
6 0.03
7 0.04
8 0.03
9 0.04
10 0.04
11 0.05
12 0.06
13 0.07
14 0.07
15 0.07
16 0.07
17 0.07
18 0.09
19 0.08
20 0.08
21 0.07
22 0.08
23 0.1
24 0.12
25 0.13
26 0.15
27 0.16
28 0.15
29 0.15
30 0.16
31 0.16
32 0.16
33 0.14
34 0.12
35 0.11
36 0.12
37 0.14
38 0.13
39 0.12
40 0.12
41 0.12
42 0.11
43 0.11
44 0.1
45 0.08
46 0.07
47 0.05
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.03
59 0.03
60 0.04
61 0.07
62 0.11
63 0.17
64 0.24
65 0.34
66 0.43
67 0.51
68 0.6
69 0.67
70 0.75
71 0.81
72 0.85