Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V8U0F6

Protein Details
Accession A0A1V8U0F6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
53-77LAVPGLREKRRERRRSAEKEVRGGGBasic
NLS Segment(s)
PositionSequence
59-77REKRRERRRSAEKEVRGGG
Subcellular Location(s) plas 19, cyto 2, extr 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
PROSITE View protein in PROSITE  
PS01309  UPF0057  
Amino Acid Sequences MVLVSLAEGILAIFLPPLAVLLRTGCSLNFLLNILLTALAWVPGVIHAWVVILAVPGLREKRRERRRSAEKEVRGGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.07
10 0.08
11 0.09
12 0.08
13 0.1
14 0.1
15 0.1
16 0.1
17 0.09
18 0.08
19 0.08
20 0.08
21 0.05
22 0.05
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.04
32 0.04
33 0.04
34 0.03
35 0.04
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.04
43 0.06
44 0.11
45 0.13
46 0.19
47 0.28
48 0.39
49 0.5
50 0.59
51 0.66
52 0.73
53 0.82
54 0.85
55 0.88
56 0.88
57 0.84
58 0.82