Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8UHT2

Protein Details
Accession A0A1V8UHT2    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
270-311NASARRPPPTQPTRKRIRTSNLSGPPKKGDRRRTLARRSGTPHydrophilic
NLS Segment(s)
PositionSequence
259-307KAGAPKRAPTSNASARRPPPTQPTRKRIRTSNLSGPPKKGDRRRTLARR
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR024610  ING_N_histone-binding  
Gene Ontology GO:0000785  C:chromatin  
Pfam View protein in Pfam  
PF12998  ING  
CDD cd16858  ING_ING3_Yng2p  
Amino Acid Sequences MALNMPEDAASVLEQFVHDVANTPAEVTHLLEEIQSKDAQILAYKDEIAKRDAALQKWVRINGGHVQNPKEEAFSKTINDCFDKCEILQAEKLGLSEKALIVLERQLKRLDVGLRHLAVREEFPADWNGPSMLSGTTTGVSTPVVHAGSNGGPLQGISGNVGVSGGAPNIANAAQLRMAHAAAATRAVAATTPATAPRAQRETSSEASKRRRPHVSLGALPTAASSLRQSSLGPGTPKASTPVPTSTSSRAGSAQPPQKAGAPKRAPTSNASARRPPPTQPTRKRIRTSNLSGPPKKGDRRRTLARRSGTPSSHSPSLSPTPSDLAASNLARQADGAAGSEEDDAEEGDDALYCFCQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.07
6 0.09
7 0.1
8 0.11
9 0.11
10 0.11
11 0.11
12 0.11
13 0.12
14 0.12
15 0.12
16 0.1
17 0.11
18 0.11
19 0.14
20 0.14
21 0.16
22 0.15
23 0.13
24 0.13
25 0.15
26 0.14
27 0.15
28 0.15
29 0.15
30 0.16
31 0.17
32 0.19
33 0.22
34 0.23
35 0.22
36 0.22
37 0.2
38 0.27
39 0.31
40 0.3
41 0.36
42 0.38
43 0.42
44 0.46
45 0.47
46 0.4
47 0.35
48 0.37
49 0.35
50 0.39
51 0.38
52 0.38
53 0.39
54 0.39
55 0.42
56 0.39
57 0.34
58 0.28
59 0.25
60 0.25
61 0.25
62 0.26
63 0.26
64 0.28
65 0.28
66 0.3
67 0.27
68 0.26
69 0.26
70 0.25
71 0.22
72 0.26
73 0.24
74 0.23
75 0.25
76 0.22
77 0.21
78 0.19
79 0.2
80 0.14
81 0.12
82 0.11
83 0.11
84 0.1
85 0.1
86 0.1
87 0.1
88 0.09
89 0.14
90 0.21
91 0.21
92 0.23
93 0.23
94 0.23
95 0.23
96 0.27
97 0.26
98 0.21
99 0.25
100 0.28
101 0.28
102 0.28
103 0.28
104 0.24
105 0.2
106 0.19
107 0.15
108 0.13
109 0.11
110 0.12
111 0.14
112 0.14
113 0.13
114 0.13
115 0.12
116 0.09
117 0.09
118 0.09
119 0.07
120 0.07
121 0.07
122 0.07
123 0.07
124 0.07
125 0.07
126 0.06
127 0.07
128 0.06
129 0.06
130 0.07
131 0.07
132 0.07
133 0.07
134 0.09
135 0.09
136 0.1
137 0.1
138 0.07
139 0.07
140 0.07
141 0.07
142 0.06
143 0.06
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.04
150 0.04
151 0.04
152 0.03
153 0.03
154 0.03
155 0.03
156 0.04
157 0.04
158 0.05
159 0.04
160 0.05
161 0.06
162 0.06
163 0.07
164 0.07
165 0.07
166 0.07
167 0.07
168 0.06
169 0.05
170 0.06
171 0.05
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.05
180 0.05
181 0.07
182 0.09
183 0.1
184 0.14
185 0.17
186 0.17
187 0.18
188 0.22
189 0.25
190 0.27
191 0.32
192 0.31
193 0.35
194 0.42
195 0.47
196 0.48
197 0.5
198 0.54
199 0.51
200 0.55
201 0.57
202 0.55
203 0.54
204 0.51
205 0.46
206 0.39
207 0.35
208 0.27
209 0.18
210 0.13
211 0.09
212 0.06
213 0.07
214 0.07
215 0.08
216 0.08
217 0.11
218 0.13
219 0.16
220 0.17
221 0.17
222 0.18
223 0.18
224 0.19
225 0.19
226 0.18
227 0.17
228 0.19
229 0.22
230 0.23
231 0.25
232 0.28
233 0.28
234 0.31
235 0.3
236 0.28
237 0.26
238 0.24
239 0.25
240 0.31
241 0.34
242 0.31
243 0.32
244 0.32
245 0.35
246 0.41
247 0.41
248 0.43
249 0.43
250 0.45
251 0.49
252 0.51
253 0.49
254 0.44
255 0.49
256 0.48
257 0.51
258 0.52
259 0.53
260 0.54
261 0.59
262 0.58
263 0.53
264 0.54
265 0.56
266 0.63
267 0.65
268 0.71
269 0.75
270 0.82
271 0.84
272 0.82
273 0.81
274 0.79
275 0.77
276 0.78
277 0.77
278 0.78
279 0.75
280 0.71
281 0.68
282 0.67
283 0.68
284 0.68
285 0.68
286 0.68
287 0.73
288 0.8
289 0.83
290 0.85
291 0.84
292 0.81
293 0.78
294 0.76
295 0.75
296 0.67
297 0.62
298 0.58
299 0.56
300 0.54
301 0.47
302 0.4
303 0.38
304 0.42
305 0.4
306 0.34
307 0.29
308 0.28
309 0.28
310 0.29
311 0.23
312 0.19
313 0.22
314 0.22
315 0.22
316 0.22
317 0.22
318 0.2
319 0.2
320 0.18
321 0.13
322 0.13
323 0.12
324 0.1
325 0.1
326 0.11
327 0.11
328 0.1
329 0.09
330 0.08
331 0.07
332 0.07
333 0.07
334 0.06
335 0.06
336 0.07
337 0.07
338 0.07