Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8UQP5

Protein Details
Accession A0A1V8UQP5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-49TSATKHIPIVKKRTQRFKRHQSDRFMRVDPSWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
12-49KKRTQRFKRHQSDRFMRVDPSWRKPKGIDNRVRRRFKG
Subcellular Location(s) mito 16.5, mito_nucl 11, cyto 6, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MTSATKHIPIVKKRTQRFKRHQSDRFMRVDPSWRKPKGIDNRVRRRFKGQAVMPKIGYGSNKKTRHLMPSGHKAFLVNNTRDLDLLLMHNKTYAAEIAHAVSSRKRVEIVSRAKQLGVKVTNGKAKLATES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.84
4 0.86
5 0.88
6 0.9
7 0.91
8 0.9
9 0.89
10 0.88
11 0.84
12 0.79
13 0.7
14 0.61
15 0.53
16 0.55
17 0.52
18 0.52
19 0.54
20 0.5
21 0.5
22 0.5
23 0.57
24 0.58
25 0.61
26 0.62
27 0.63
28 0.73
29 0.8
30 0.84
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.58
38 0.57
39 0.57
40 0.5
41 0.43
42 0.38
43 0.3
44 0.27
45 0.22
46 0.24
47 0.31
48 0.33
49 0.34
50 0.37
51 0.38
52 0.41
53 0.4
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.31
62 0.33
63 0.34
64 0.24
65 0.25
66 0.26
67 0.26
68 0.26
69 0.25
70 0.18
71 0.11
72 0.13
73 0.12
74 0.11
75 0.1
76 0.11
77 0.11
78 0.11
79 0.11
80 0.1
81 0.07
82 0.08
83 0.09
84 0.09
85 0.1
86 0.11
87 0.11
88 0.12
89 0.17
90 0.17
91 0.18
92 0.18
93 0.19
94 0.25
95 0.33
96 0.41
97 0.44
98 0.49
99 0.49
100 0.49
101 0.5
102 0.45
103 0.45
104 0.38
105 0.35
106 0.35
107 0.39
108 0.45
109 0.43
110 0.43
111 0.36