Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V8UUR9

Protein Details
Accession A0A1V8UUR9    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
405-426PPSSRDRRTEVKREEPEKRRAIBasic
429-462RRELDRVRERDRDRQRPRDRERDRDGHRDRHGRRBasic
478-497RRYGEERRPREDRRYRDERRBasic
NLS Segment(s)
PositionSequence
407-497SSRDRRTEVKREEPEKRRAIDERRELDRVRERDRDRQRPRDRERDRDGHRDRHGRRYDDDRRRYDDRRYDERRYGEERRPREDRRYRDERR
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR043198  Cyclin/Ssn8  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Amino Acid Sequences MVSQKRMSNGEPKPPVGPHPSTIRVSAQYVSQAGVEQQLAQTTGDAQERSLAEAKEDSLRLQGVQWIDVVRRALHLPVRTYTTACTYYHKFRLAHPPGTTTGDGYLWSDAAAASLLTACKMEDTLKKSREVLAASYNLKLSAAHEQLPADDPIFEQPSRIVIGLERLVLEAGSFDFRSRAPHQVLSKIARSLGKGEDVKKVHDLAWTDIYRTFAPLKHTASTLAFATLELAARLSAEEAVLQRLQQVSMPAWQTSRAEIMETELDSLDLYIQHTTSSILGARYSLDDFLRIRLALNKECNDKSIPRYCMAPTPQAPTSQVQNGHPTPVSPPQPGSTQQSLQIPASAPEYAPVVGTGTLRFMLNPQLAKNERDQVESHFKEEWEEYEEEIEVPIPRSERPAPSTGPPSSRDRRTEVKREEPEKRRAIDERRELDRVRERDRDRQRPRDRERDRDGHRDRHGRRYDDDRRRYDDRRYDERRYGEERRPREDRRYRDERR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.52
4 0.5
5 0.44
6 0.46
7 0.5
8 0.47
9 0.48
10 0.46
11 0.41
12 0.39
13 0.36
14 0.3
15 0.27
16 0.26
17 0.23
18 0.19
19 0.17
20 0.15
21 0.16
22 0.15
23 0.12
24 0.12
25 0.12
26 0.13
27 0.12
28 0.12
29 0.11
30 0.14
31 0.17
32 0.16
33 0.15
34 0.19
35 0.19
36 0.23
37 0.27
38 0.23
39 0.21
40 0.22
41 0.24
42 0.24
43 0.24
44 0.21
45 0.19
46 0.2
47 0.18
48 0.18
49 0.2
50 0.16
51 0.16
52 0.16
53 0.15
54 0.15
55 0.18
56 0.19
57 0.15
58 0.16
59 0.17
60 0.2
61 0.23
62 0.27
63 0.27
64 0.28
65 0.33
66 0.33
67 0.32
68 0.3
69 0.3
70 0.29
71 0.27
72 0.3
73 0.3
74 0.36
75 0.41
76 0.46
77 0.41
78 0.44
79 0.55
80 0.56
81 0.57
82 0.51
83 0.48
84 0.45
85 0.49
86 0.43
87 0.32
88 0.26
89 0.2
90 0.19
91 0.17
92 0.14
93 0.09
94 0.09
95 0.08
96 0.06
97 0.06
98 0.06
99 0.04
100 0.04
101 0.05
102 0.05
103 0.05
104 0.06
105 0.05
106 0.05
107 0.06
108 0.1
109 0.15
110 0.21
111 0.3
112 0.33
113 0.35
114 0.36
115 0.39
116 0.39
117 0.35
118 0.32
119 0.28
120 0.3
121 0.29
122 0.29
123 0.25
124 0.21
125 0.2
126 0.17
127 0.14
128 0.17
129 0.17
130 0.18
131 0.19
132 0.19
133 0.2
134 0.22
135 0.21
136 0.13
137 0.11
138 0.1
139 0.12
140 0.15
141 0.14
142 0.12
143 0.12
144 0.13
145 0.14
146 0.14
147 0.11
148 0.08
149 0.11
150 0.12
151 0.12
152 0.1
153 0.09
154 0.09
155 0.09
156 0.08
157 0.05
158 0.05
159 0.06
160 0.06
161 0.06
162 0.07
163 0.08
164 0.14
165 0.16
166 0.22
167 0.23
168 0.28
169 0.31
170 0.34
171 0.39
172 0.36
173 0.36
174 0.31
175 0.3
176 0.26
177 0.25
178 0.23
179 0.2
180 0.22
181 0.23
182 0.24
183 0.29
184 0.29
185 0.3
186 0.29
187 0.28
188 0.23
189 0.23
190 0.22
191 0.18
192 0.24
193 0.22
194 0.21
195 0.21
196 0.22
197 0.2
198 0.2
199 0.19
200 0.14
201 0.19
202 0.22
203 0.23
204 0.22
205 0.23
206 0.22
207 0.21
208 0.2
209 0.16
210 0.12
211 0.1
212 0.08
213 0.09
214 0.07
215 0.07
216 0.05
217 0.05
218 0.04
219 0.04
220 0.04
221 0.04
222 0.03
223 0.03
224 0.04
225 0.05
226 0.06
227 0.07
228 0.06
229 0.07
230 0.08
231 0.08
232 0.08
233 0.08
234 0.07
235 0.11
236 0.12
237 0.11
238 0.11
239 0.12
240 0.12
241 0.12
242 0.13
243 0.09
244 0.09
245 0.08
246 0.1
247 0.09
248 0.09
249 0.09
250 0.07
251 0.07
252 0.06
253 0.06
254 0.05
255 0.04
256 0.05
257 0.04
258 0.05
259 0.05
260 0.05
261 0.06
262 0.05
263 0.06
264 0.06
265 0.07
266 0.07
267 0.07
268 0.07
269 0.08
270 0.08
271 0.08
272 0.07
273 0.09
274 0.09
275 0.11
276 0.11
277 0.1
278 0.1
279 0.15
280 0.19
281 0.21
282 0.26
283 0.27
284 0.31
285 0.32
286 0.33
287 0.31
288 0.3
289 0.32
290 0.35
291 0.35
292 0.3
293 0.32
294 0.31
295 0.35
296 0.35
297 0.35
298 0.29
299 0.32
300 0.32
301 0.31
302 0.32
303 0.27
304 0.28
305 0.25
306 0.26
307 0.23
308 0.28
309 0.27
310 0.28
311 0.26
312 0.23
313 0.22
314 0.26
315 0.28
316 0.23
317 0.24
318 0.23
319 0.26
320 0.29
321 0.32
322 0.29
323 0.27
324 0.28
325 0.3
326 0.3
327 0.28
328 0.27
329 0.2
330 0.17
331 0.18
332 0.15
333 0.12
334 0.1
335 0.11
336 0.09
337 0.09
338 0.08
339 0.07
340 0.07
341 0.08
342 0.08
343 0.08
344 0.08
345 0.08
346 0.08
347 0.08
348 0.13
349 0.16
350 0.17
351 0.17
352 0.24
353 0.27
354 0.29
355 0.32
356 0.34
357 0.32
358 0.33
359 0.34
360 0.32
361 0.41
362 0.4
363 0.39
364 0.33
365 0.31
366 0.31
367 0.31
368 0.26
369 0.21
370 0.2
371 0.18
372 0.17
373 0.18
374 0.15
375 0.14
376 0.14
377 0.1
378 0.1
379 0.12
380 0.12
381 0.12
382 0.18
383 0.22
384 0.26
385 0.29
386 0.32
387 0.33
388 0.38
389 0.44
390 0.42
391 0.42
392 0.4
393 0.44
394 0.48
395 0.53
396 0.52
397 0.51
398 0.57
399 0.62
400 0.69
401 0.69
402 0.71
403 0.73
404 0.77
405 0.82
406 0.8
407 0.81
408 0.78
409 0.72
410 0.68
411 0.66
412 0.68
413 0.67
414 0.69
415 0.66
416 0.64
417 0.67
418 0.62
419 0.62
420 0.63
421 0.59
422 0.57
423 0.59
424 0.59
425 0.64
426 0.74
427 0.76
428 0.77
429 0.81
430 0.85
431 0.86
432 0.9
433 0.91
434 0.89
435 0.88
436 0.87
437 0.86
438 0.83
439 0.83
440 0.82
441 0.8
442 0.81
443 0.81
444 0.77
445 0.77
446 0.79
447 0.72
448 0.7
449 0.71
450 0.72
451 0.73
452 0.78
453 0.74
454 0.73
455 0.76
456 0.76
457 0.75
458 0.74
459 0.72
460 0.73
461 0.74
462 0.75
463 0.75
464 0.76
465 0.73
466 0.71
467 0.7
468 0.7
469 0.71
470 0.7
471 0.7
472 0.73
473 0.73
474 0.76
475 0.78
476 0.78
477 0.78