Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8UAT0

Protein Details
Accession A0A1V8UAT0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-84ALVKNPDKYERRKRDNKKSNDTKASLHydrophilic
NLS Segment(s)
PositionSequence
69-75RRKRDNK
Subcellular Location(s) nucl 13.5, cyto_nucl 12, cyto 7.5, pero 3
Family & Domain DBs
Amino Acid Sequences TAVSYHAGGPTYYDIGGDNNGYGEDKNPTFSQRLNHIIQLLRRNKDIAMDVIEGRGVTALVKNPDKYERRKRDNKKSNDTKASLQEKGKRLEALEQRTASRSMVPGPVVQSVEGAPVGNQVSAHSHEGMDFSEAVSDDLKQYYEVQPEWQVGEVGLGAAEPEARQAPDGYRAAGQAGWQPGDPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.15
4 0.13
5 0.1
6 0.09
7 0.09
8 0.1
9 0.1
10 0.1
11 0.14
12 0.14
13 0.17
14 0.18
15 0.21
16 0.22
17 0.25
18 0.28
19 0.29
20 0.35
21 0.34
22 0.35
23 0.35
24 0.37
25 0.39
26 0.44
27 0.45
28 0.41
29 0.4
30 0.39
31 0.36
32 0.35
33 0.32
34 0.24
35 0.21
36 0.2
37 0.19
38 0.18
39 0.17
40 0.14
41 0.12
42 0.1
43 0.06
44 0.04
45 0.06
46 0.08
47 0.13
48 0.15
49 0.16
50 0.18
51 0.26
52 0.32
53 0.39
54 0.48
55 0.54
56 0.61
57 0.71
58 0.79
59 0.83
60 0.88
61 0.88
62 0.88
63 0.88
64 0.87
65 0.84
66 0.76
67 0.68
68 0.67
69 0.61
70 0.55
71 0.49
72 0.47
73 0.44
74 0.44
75 0.42
76 0.34
77 0.3
78 0.33
79 0.34
80 0.33
81 0.32
82 0.31
83 0.3
84 0.31
85 0.31
86 0.24
87 0.19
88 0.14
89 0.11
90 0.12
91 0.12
92 0.12
93 0.12
94 0.14
95 0.13
96 0.13
97 0.11
98 0.09
99 0.09
100 0.08
101 0.07
102 0.05
103 0.07
104 0.07
105 0.07
106 0.07
107 0.06
108 0.09
109 0.11
110 0.13
111 0.12
112 0.11
113 0.11
114 0.12
115 0.12
116 0.11
117 0.09
118 0.07
119 0.07
120 0.08
121 0.08
122 0.08
123 0.08
124 0.07
125 0.08
126 0.09
127 0.08
128 0.11
129 0.14
130 0.17
131 0.18
132 0.19
133 0.22
134 0.22
135 0.22
136 0.2
137 0.17
138 0.13
139 0.13
140 0.1
141 0.07
142 0.06
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.06
149 0.07
150 0.08
151 0.09
152 0.11
153 0.13
154 0.2
155 0.21
156 0.21
157 0.21
158 0.21
159 0.21
160 0.2
161 0.19
162 0.18
163 0.2
164 0.2