Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8U3M8

Protein Details
Accession A0A1V8U3M8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-45LWKIPWRLSAPQKLRHRRRMRRVDNIVSVLHydrophilic
144-171RKAKGYRKGVHKLPKWTRVSQRVNPPGFHydrophilic
NLS Segment(s)
PositionSequence
30-34RHRRR
Subcellular Location(s) mito 23, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKPSAPLSVGLLWKIPWRLSAPQKLRHRRRMRRVDNIVSVLDTALQRHAGSSALRPNPQSNSPDALTPASSSKPTTTAVSTSRTKRPAPGSFPTSPATTVSNPSLSARALGTIKLVERWKAEMPTEKEMLPKDKYTMFDRKAKGYRKGVHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.19
4 0.22
5 0.23
6 0.21
7 0.19
8 0.22
9 0.29
10 0.37
11 0.47
12 0.5
13 0.57
14 0.67
15 0.75
16 0.81
17 0.84
18 0.87
19 0.87
20 0.91
21 0.92
22 0.91
23 0.91
24 0.9
25 0.86
26 0.8
27 0.72
28 0.61
29 0.5
30 0.41
31 0.3
32 0.23
33 0.16
34 0.11
35 0.09
36 0.09
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.12
43 0.19
44 0.22
45 0.23
46 0.25
47 0.27
48 0.29
49 0.32
50 0.31
51 0.26
52 0.26
53 0.25
54 0.24
55 0.22
56 0.2
57 0.16
58 0.15
59 0.14
60 0.11
61 0.11
62 0.11
63 0.1
64 0.11
65 0.12
66 0.13
67 0.12
68 0.14
69 0.15
70 0.19
71 0.23
72 0.25
73 0.29
74 0.31
75 0.31
76 0.33
77 0.38
78 0.39
79 0.4
80 0.42
81 0.43
82 0.4
83 0.43
84 0.4
85 0.33
86 0.28
87 0.24
88 0.21
89 0.16
90 0.17
91 0.16
92 0.15
93 0.15
94 0.15
95 0.15
96 0.12
97 0.12
98 0.1
99 0.11
100 0.1
101 0.1
102 0.1
103 0.1
104 0.1
105 0.14
106 0.15
107 0.15
108 0.16
109 0.2
110 0.22
111 0.23
112 0.26
113 0.3
114 0.33
115 0.36
116 0.36
117 0.33
118 0.33
119 0.35
120 0.37
121 0.32
122 0.29
123 0.27
124 0.29
125 0.32
126 0.35
127 0.41
128 0.41
129 0.45
130 0.47
131 0.53
132 0.58
133 0.63
134 0.65
135 0.65
136 0.69
137 0.7
138 0.76
139 0.76
140 0.78
141 0.77
142 0.79
143 0.79
144 0.81
145 0.78
146 0.78
147 0.79
148 0.79
149 0.81
150 0.78
151 0.8