Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TZP3

Protein Details
Accession A0A1V8TZP3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-89EKGEKATPKKRGRKVTKENDDDEETPAKKTKAIPKRGKKVPKANEDGDBasic
NLS Segment(s)
PositionSequence
43-58KGEKATPKKRGRKVTK
67-83PAKKTKAIPKRGKKVPK
Subcellular Location(s) mito 16, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MEKFAELGGFANLNSAQANYHGIWKKVMEGSAGATGEGGEGEKGEKATPKKRGRKVTKENDDDEETPAKKTKAIPKRGKKVPKANEDGDGEEDVKVKNEDGAGEEDEET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.09
5 0.12
6 0.11
7 0.19
8 0.22
9 0.23
10 0.24
11 0.24
12 0.26
13 0.25
14 0.25
15 0.17
16 0.15
17 0.16
18 0.17
19 0.16
20 0.13
21 0.1
22 0.1
23 0.09
24 0.08
25 0.06
26 0.03
27 0.03
28 0.04
29 0.04
30 0.05
31 0.06
32 0.1
33 0.15
34 0.22
35 0.32
36 0.41
37 0.5
38 0.58
39 0.68
40 0.73
41 0.79
42 0.83
43 0.84
44 0.84
45 0.8
46 0.74
47 0.67
48 0.62
49 0.52
50 0.44
51 0.38
52 0.28
53 0.25
54 0.25
55 0.21
56 0.19
57 0.24
58 0.31
59 0.36
60 0.46
61 0.56
62 0.63
63 0.73
64 0.81
65 0.85
66 0.85
67 0.86
68 0.85
69 0.84
70 0.81
71 0.73
72 0.7
73 0.62
74 0.55
75 0.47
76 0.39
77 0.3
78 0.23
79 0.22
80 0.16
81 0.16
82 0.14
83 0.12
84 0.12
85 0.12
86 0.12
87 0.14
88 0.17
89 0.17