Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8V7H6

Protein Details
Accession A0A1V8V7H6    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-29DYDEPRRYRTSRVRPRERDEPEFVBasic
113-157GYAAGRRKEKAHRHRRDDRDYYDSEHSRSPPRKDRRKSGVEDLLGBasic
NLS Segment(s)
PositionSequence
117-128GRRKEKAHRHRR
144-148RKDRR
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MSAYDDYDEPRRYRTSRVRPRERDEPEFVREETYIERGKGPGPRDLVFRGRDDSVEDIPRDFPPPGRDARRSYDEYSQAPRRTRSVGRRDYDDYDDDRYTDYAAPAAAGGAAGYAAGRRKEKAHRHRRDDRDYYDSEHSRSPPRKDRRKSGVEDLLGGLGLGGLVGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.62
4 0.72
5 0.79
6 0.82
7 0.87
8 0.88
9 0.85
10 0.81
11 0.77
12 0.72
13 0.65
14 0.6
15 0.52
16 0.44
17 0.36
18 0.3
19 0.25
20 0.24
21 0.22
22 0.2
23 0.2
24 0.19
25 0.22
26 0.26
27 0.26
28 0.26
29 0.27
30 0.28
31 0.3
32 0.33
33 0.35
34 0.32
35 0.32
36 0.3
37 0.26
38 0.25
39 0.24
40 0.24
41 0.21
42 0.22
43 0.21
44 0.19
45 0.2
46 0.2
47 0.2
48 0.17
49 0.16
50 0.16
51 0.19
52 0.24
53 0.28
54 0.32
55 0.34
56 0.39
57 0.42
58 0.43
59 0.43
60 0.42
61 0.4
62 0.37
63 0.4
64 0.41
65 0.4
66 0.39
67 0.37
68 0.34
69 0.35
70 0.39
71 0.42
72 0.45
73 0.48
74 0.48
75 0.51
76 0.52
77 0.51
78 0.47
79 0.41
80 0.33
81 0.29
82 0.27
83 0.22
84 0.2
85 0.17
86 0.15
87 0.13
88 0.11
89 0.08
90 0.07
91 0.07
92 0.06
93 0.06
94 0.04
95 0.03
96 0.03
97 0.02
98 0.02
99 0.02
100 0.02
101 0.03
102 0.06
103 0.09
104 0.11
105 0.13
106 0.18
107 0.28
108 0.39
109 0.49
110 0.58
111 0.65
112 0.74
113 0.83
114 0.88
115 0.88
116 0.86
117 0.8
118 0.76
119 0.68
120 0.63
121 0.61
122 0.54
123 0.46
124 0.42
125 0.4
126 0.43
127 0.48
128 0.52
129 0.53
130 0.62
131 0.71
132 0.76
133 0.83
134 0.83
135 0.85
136 0.83
137 0.83
138 0.81
139 0.72
140 0.64
141 0.55
142 0.45
143 0.35
144 0.28
145 0.17
146 0.08
147 0.06