Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9P696

Protein Details
Accession G9P696    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
64-90AAQRTDDGARRKKRRRHRQAITWDVVEHydrophilic
NLS Segment(s)
PositionSequence
72-81ARRKKRRRHR
Subcellular Location(s) plas 12, mito 7, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
Amino Acid Sequences MSSFNATPPAPKPATYEFVVGQRPDQLNAGSNKKLRSHLSKRGWEAYLEQKKLSSPVSVRVDEAAQRTDDGARRKKRRRHRQAITWDVVEPDDPRFPGPGNVREAMLALIKTGRHTPLEKTLSIDYRLGGGRVDPFKSYPTPFRSYIPHLVDHYIIHMAVDIPELDQPGNAGLLRSRWFRMATSEMSTFQVVLLLAAGNFVSVKGAVPAEQGFDIHQLKGDAIQSLKYAMNDEAKATSDSIIGAVAKLASFESMHGSEADFRLHMEHTIRLVNMRGGLNNLGLGGLLRRMLIWIDVNGNFLYKRPRYWPGENFDGSKDSISEPNPERFIAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.38
4 0.31
5 0.35
6 0.39
7 0.34
8 0.3
9 0.33
10 0.32
11 0.3
12 0.3
13 0.26
14 0.27
15 0.33
16 0.37
17 0.36
18 0.39
19 0.42
20 0.44
21 0.48
22 0.49
23 0.53
24 0.57
25 0.61
26 0.67
27 0.71
28 0.73
29 0.74
30 0.68
31 0.59
32 0.54
33 0.54
34 0.54
35 0.47
36 0.42
37 0.36
38 0.36
39 0.38
40 0.35
41 0.3
42 0.22
43 0.29
44 0.35
45 0.35
46 0.34
47 0.33
48 0.33
49 0.31
50 0.31
51 0.24
52 0.18
53 0.18
54 0.18
55 0.21
56 0.24
57 0.29
58 0.36
59 0.44
60 0.55
61 0.64
62 0.73
63 0.8
64 0.87
65 0.89
66 0.91
67 0.91
68 0.91
69 0.92
70 0.92
71 0.85
72 0.75
73 0.64
74 0.53
75 0.43
76 0.34
77 0.24
78 0.16
79 0.14
80 0.13
81 0.13
82 0.13
83 0.14
84 0.19
85 0.23
86 0.26
87 0.29
88 0.29
89 0.28
90 0.27
91 0.27
92 0.22
93 0.17
94 0.12
95 0.08
96 0.08
97 0.08
98 0.1
99 0.11
100 0.12
101 0.14
102 0.16
103 0.18
104 0.26
105 0.29
106 0.28
107 0.29
108 0.31
109 0.3
110 0.31
111 0.28
112 0.19
113 0.18
114 0.18
115 0.15
116 0.12
117 0.1
118 0.13
119 0.15
120 0.15
121 0.14
122 0.14
123 0.17
124 0.19
125 0.21
126 0.23
127 0.26
128 0.3
129 0.31
130 0.32
131 0.34
132 0.37
133 0.42
134 0.38
135 0.34
136 0.3
137 0.3
138 0.29
139 0.24
140 0.2
141 0.13
142 0.1
143 0.08
144 0.07
145 0.05
146 0.05
147 0.05
148 0.04
149 0.04
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.04
156 0.05
157 0.04
158 0.04
159 0.04
160 0.06
161 0.08
162 0.1
163 0.11
164 0.12
165 0.13
166 0.13
167 0.17
168 0.19
169 0.19
170 0.2
171 0.21
172 0.2
173 0.2
174 0.2
175 0.16
176 0.12
177 0.11
178 0.08
179 0.06
180 0.05
181 0.04
182 0.04
183 0.04
184 0.04
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.04
192 0.05
193 0.05
194 0.06
195 0.06
196 0.07
197 0.07
198 0.07
199 0.07
200 0.11
201 0.12
202 0.11
203 0.12
204 0.11
205 0.11
206 0.13
207 0.13
208 0.1
209 0.1
210 0.11
211 0.1
212 0.12
213 0.13
214 0.11
215 0.12
216 0.13
217 0.16
218 0.16
219 0.17
220 0.15
221 0.16
222 0.16
223 0.15
224 0.14
225 0.1
226 0.1
227 0.09
228 0.09
229 0.07
230 0.06
231 0.06
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.05
238 0.06
239 0.09
240 0.1
241 0.11
242 0.11
243 0.11
244 0.13
245 0.14
246 0.15
247 0.11
248 0.1
249 0.11
250 0.12
251 0.14
252 0.13
253 0.14
254 0.15
255 0.18
256 0.18
257 0.18
258 0.19
259 0.18
260 0.2
261 0.19
262 0.18
263 0.18
264 0.19
265 0.17
266 0.16
267 0.14
268 0.1
269 0.08
270 0.08
271 0.06
272 0.06
273 0.06
274 0.06
275 0.06
276 0.07
277 0.07
278 0.09
279 0.1
280 0.11
281 0.15
282 0.16
283 0.18
284 0.18
285 0.19
286 0.17
287 0.17
288 0.25
289 0.23
290 0.27
291 0.31
292 0.4
293 0.47
294 0.56
295 0.62
296 0.6
297 0.66
298 0.65
299 0.61
300 0.55
301 0.5
302 0.42
303 0.34
304 0.28
305 0.22
306 0.24
307 0.23
308 0.29
309 0.31
310 0.37
311 0.38