Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TXL7

Protein Details
Accession A0A1V8TXL7    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21SSCFGSRKKRTGEREPLLPQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045967  DUF5923  
Pfam View protein in Pfam  
PF19343  DUF5923  
Amino Acid Sequences MSSCFGSRKKRTGEREPLLPQYEDETILQRELHQKLHTYQQLRAISKGFMPSTEQTIINLRTLLASDVLNPENADLSDSGRLLTKHTKTWLTQFMDLLQHKNDKDQIQDVIWFLSKSRIDVDVEDITRRASKSKAKADTAAAYKSIQTIGSLLLTNSDFRVFLNDLSVVGREVFKDSAFKLSNVAKKTAKRIEPSQAERQAVAKPGDDAELERPSAEDLSQNVAQVGKEIANGTSEVAKVAFKSAEEKLEGDEGQTMLNRLQEVVTKLRKRNDYSDSVSTLSLLIKRYAMVYSRAAAEVANVVQEDVNQNAETDRALHNFWIFIKSFGDTASWEKSEELLKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.77
4 0.75
5 0.69
6 0.61
7 0.5
8 0.43
9 0.39
10 0.31
11 0.27
12 0.23
13 0.21
14 0.21
15 0.2
16 0.2
17 0.26
18 0.27
19 0.31
20 0.3
21 0.33
22 0.34
23 0.44
24 0.47
25 0.43
26 0.43
27 0.47
28 0.53
29 0.5
30 0.5
31 0.42
32 0.36
33 0.36
34 0.37
35 0.29
36 0.22
37 0.25
38 0.24
39 0.27
40 0.29
41 0.26
42 0.22
43 0.28
44 0.29
45 0.25
46 0.23
47 0.18
48 0.15
49 0.16
50 0.15
51 0.11
52 0.09
53 0.1
54 0.13
55 0.14
56 0.14
57 0.13
58 0.12
59 0.12
60 0.12
61 0.12
62 0.08
63 0.09
64 0.11
65 0.11
66 0.11
67 0.12
68 0.13
69 0.15
70 0.23
71 0.24
72 0.27
73 0.31
74 0.35
75 0.34
76 0.41
77 0.45
78 0.41
79 0.41
80 0.37
81 0.35
82 0.39
83 0.38
84 0.34
85 0.28
86 0.29
87 0.27
88 0.3
89 0.32
90 0.26
91 0.28
92 0.28
93 0.27
94 0.23
95 0.24
96 0.21
97 0.18
98 0.17
99 0.14
100 0.12
101 0.16
102 0.15
103 0.14
104 0.15
105 0.16
106 0.16
107 0.17
108 0.21
109 0.19
110 0.19
111 0.19
112 0.18
113 0.16
114 0.18
115 0.17
116 0.15
117 0.15
118 0.22
119 0.3
120 0.39
121 0.44
122 0.44
123 0.46
124 0.46
125 0.47
126 0.43
127 0.35
128 0.27
129 0.22
130 0.2
131 0.18
132 0.16
133 0.1
134 0.07
135 0.07
136 0.06
137 0.07
138 0.07
139 0.06
140 0.07
141 0.07
142 0.07
143 0.07
144 0.07
145 0.06
146 0.06
147 0.1
148 0.09
149 0.09
150 0.1
151 0.09
152 0.09
153 0.1
154 0.1
155 0.07
156 0.06
157 0.07
158 0.06
159 0.07
160 0.07
161 0.07
162 0.08
163 0.08
164 0.14
165 0.15
166 0.15
167 0.17
168 0.21
169 0.26
170 0.26
171 0.3
172 0.28
173 0.3
174 0.37
175 0.41
176 0.4
177 0.4
178 0.42
179 0.47
180 0.5
181 0.53
182 0.55
183 0.53
184 0.49
185 0.45
186 0.43
187 0.36
188 0.33
189 0.28
190 0.19
191 0.15
192 0.15
193 0.15
194 0.13
195 0.13
196 0.12
197 0.13
198 0.12
199 0.12
200 0.11
201 0.11
202 0.11
203 0.1
204 0.08
205 0.08
206 0.13
207 0.13
208 0.13
209 0.13
210 0.13
211 0.13
212 0.12
213 0.12
214 0.07
215 0.08
216 0.08
217 0.08
218 0.08
219 0.09
220 0.08
221 0.09
222 0.08
223 0.08
224 0.08
225 0.08
226 0.07
227 0.09
228 0.09
229 0.08
230 0.12
231 0.13
232 0.15
233 0.16
234 0.16
235 0.16
236 0.18
237 0.18
238 0.14
239 0.14
240 0.12
241 0.11
242 0.11
243 0.11
244 0.09
245 0.11
246 0.1
247 0.09
248 0.1
249 0.12
250 0.15
251 0.22
252 0.31
253 0.37
254 0.42
255 0.49
256 0.56
257 0.57
258 0.61
259 0.6
260 0.58
261 0.58
262 0.57
263 0.53
264 0.47
265 0.42
266 0.34
267 0.28
268 0.23
269 0.19
270 0.16
271 0.15
272 0.14
273 0.14
274 0.15
275 0.16
276 0.17
277 0.18
278 0.18
279 0.19
280 0.2
281 0.2
282 0.19
283 0.16
284 0.15
285 0.13
286 0.11
287 0.11
288 0.09
289 0.09
290 0.09
291 0.1
292 0.11
293 0.1
294 0.13
295 0.12
296 0.12
297 0.12
298 0.12
299 0.12
300 0.12
301 0.14
302 0.14
303 0.16
304 0.17
305 0.18
306 0.2
307 0.21
308 0.23
309 0.2
310 0.2
311 0.2
312 0.19
313 0.19
314 0.17
315 0.17
316 0.14
317 0.18
318 0.23
319 0.22
320 0.22
321 0.22
322 0.23