Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8V9K3

Protein Details
Accession A0A1V8V9K3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
30-49APPSPAKKPARKQARKEGTTHydrophilic
NLS Segment(s)
PositionSequence
30-45APPSPAKKPARKQARK
61-70AKIRQRAPPK
Subcellular Location(s) mito 18.5, mito_nucl 12.5, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MDTKKKPAAAPVLPAATKKCTRKQAALSAAPPSPAKKPARKQARKEGTTVGVDMVFKGRVAKIRQRAPPKPKQTPVNVVESESGSGSAPHGVDLSKAGQRDDEQDVFLRNHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.37
3 0.35
4 0.39
5 0.4
6 0.43
7 0.48
8 0.53
9 0.59
10 0.63
11 0.66
12 0.67
13 0.65
14 0.59
15 0.53
16 0.48
17 0.42
18 0.36
19 0.28
20 0.23
21 0.26
22 0.31
23 0.36
24 0.44
25 0.52
26 0.63
27 0.7
28 0.74
29 0.78
30 0.81
31 0.74
32 0.69
33 0.62
34 0.54
35 0.46
36 0.38
37 0.27
38 0.17
39 0.16
40 0.13
41 0.11
42 0.07
43 0.06
44 0.07
45 0.07
46 0.12
47 0.16
48 0.23
49 0.29
50 0.37
51 0.44
52 0.52
53 0.61
54 0.64
55 0.71
56 0.73
57 0.75
58 0.74
59 0.74
60 0.71
61 0.71
62 0.65
63 0.62
64 0.53
65 0.45
66 0.4
67 0.34
68 0.28
69 0.19
70 0.17
71 0.09
72 0.09
73 0.08
74 0.09
75 0.08
76 0.08
77 0.08
78 0.08
79 0.08
80 0.1
81 0.13
82 0.14
83 0.15
84 0.15
85 0.17
86 0.18
87 0.22
88 0.27
89 0.25
90 0.24
91 0.26
92 0.29