Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8UX20

Protein Details
Accession A0A1V8UX20    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-67CDEPSEKKKHDRYIHLREYLBasic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_mito 10.833, cyto_nucl 9.833, mito 5.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001279  Metallo-B-lactamas  
IPR036866  RibonucZ/Hydroxyglut_hydro  
Pfam View protein in Pfam  
PF00753  Lactamase_B  
CDD cd06262  metallo-hydrolase-like_MBL-fold  
Amino Acid Sequences MPSSTFTASKLNSTTFLLIEDEVYDEYPHIYIKLHPTADVCIITDTGCDEPSEKKKHDRYIHLREYLESCPLPCNNNSPLNPGGKRTYLTICTHCHYDHIGGVAQFLRGGQTSILASGYGRDFIESNLPKHSYFDAIGKSTPYFSVTHWAESFERLRWPLPMPGQPKGGEGERVDLGVTVIATPGHTPDELAWYDEGEMHLYVGDSFYEEGEQGMPIIWGPGQGDLVEWAYSMGKLLQFVKSKNAEAVAKAEETGAGEWTVVAKRVKVGCGHQTPAADGEELLEKLAKGWWQLVKEELPVYKETKVAGEAMTWWRKKDGGPHSLSFQAPVRIVEDARAFFAGAERRGFTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.22
3 0.23
4 0.2
5 0.17
6 0.15
7 0.14
8 0.12
9 0.11
10 0.12
11 0.11
12 0.09
13 0.1
14 0.1
15 0.1
16 0.09
17 0.1
18 0.13
19 0.2
20 0.27
21 0.26
22 0.27
23 0.28
24 0.3
25 0.32
26 0.29
27 0.23
28 0.17
29 0.16
30 0.15
31 0.14
32 0.13
33 0.11
34 0.1
35 0.1
36 0.1
37 0.17
38 0.26
39 0.34
40 0.36
41 0.45
42 0.52
43 0.62
44 0.69
45 0.73
46 0.74
47 0.77
48 0.82
49 0.78
50 0.71
51 0.64
52 0.59
53 0.5
54 0.44
55 0.34
56 0.26
57 0.24
58 0.25
59 0.26
60 0.24
61 0.27
62 0.28
63 0.35
64 0.35
65 0.36
66 0.38
67 0.42
68 0.42
69 0.41
70 0.39
71 0.33
72 0.33
73 0.31
74 0.31
75 0.29
76 0.32
77 0.33
78 0.33
79 0.33
80 0.35
81 0.32
82 0.29
83 0.26
84 0.24
85 0.2
86 0.18
87 0.18
88 0.15
89 0.16
90 0.15
91 0.12
92 0.11
93 0.09
94 0.08
95 0.07
96 0.07
97 0.06
98 0.07
99 0.07
100 0.07
101 0.07
102 0.06
103 0.06
104 0.07
105 0.08
106 0.08
107 0.07
108 0.08
109 0.08
110 0.08
111 0.18
112 0.18
113 0.19
114 0.22
115 0.23
116 0.23
117 0.25
118 0.25
119 0.18
120 0.17
121 0.19
122 0.18
123 0.17
124 0.18
125 0.17
126 0.17
127 0.15
128 0.14
129 0.12
130 0.11
131 0.1
132 0.18
133 0.18
134 0.2
135 0.19
136 0.22
137 0.2
138 0.22
139 0.23
140 0.16
141 0.17
142 0.16
143 0.17
144 0.16
145 0.18
146 0.19
147 0.21
148 0.26
149 0.27
150 0.28
151 0.31
152 0.29
153 0.28
154 0.26
155 0.23
156 0.19
157 0.16
158 0.16
159 0.13
160 0.13
161 0.12
162 0.1
163 0.09
164 0.06
165 0.06
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.04
172 0.05
173 0.05
174 0.05
175 0.05
176 0.09
177 0.09
178 0.1
179 0.09
180 0.09
181 0.09
182 0.09
183 0.09
184 0.07
185 0.06
186 0.05
187 0.05
188 0.05
189 0.05
190 0.05
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.04
197 0.05
198 0.05
199 0.05
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.06
213 0.07
214 0.06
215 0.06
216 0.06
217 0.06
218 0.06
219 0.06
220 0.06
221 0.06
222 0.08
223 0.09
224 0.15
225 0.17
226 0.19
227 0.25
228 0.27
229 0.28
230 0.27
231 0.29
232 0.24
233 0.22
234 0.24
235 0.19
236 0.16
237 0.16
238 0.15
239 0.12
240 0.11
241 0.11
242 0.09
243 0.07
244 0.06
245 0.06
246 0.08
247 0.08
248 0.11
249 0.12
250 0.11
251 0.16
252 0.19
253 0.21
254 0.23
255 0.27
256 0.32
257 0.36
258 0.38
259 0.36
260 0.34
261 0.33
262 0.32
263 0.28
264 0.19
265 0.14
266 0.13
267 0.13
268 0.12
269 0.12
270 0.1
271 0.09
272 0.09
273 0.12
274 0.12
275 0.1
276 0.15
277 0.19
278 0.2
279 0.22
280 0.25
281 0.25
282 0.26
283 0.28
284 0.25
285 0.24
286 0.25
287 0.26
288 0.24
289 0.24
290 0.22
291 0.2
292 0.2
293 0.18
294 0.16
295 0.14
296 0.16
297 0.24
298 0.32
299 0.32
300 0.32
301 0.32
302 0.34
303 0.35
304 0.41
305 0.42
306 0.43
307 0.48
308 0.49
309 0.51
310 0.54
311 0.52
312 0.45
313 0.39
314 0.34
315 0.29
316 0.27
317 0.25
318 0.23
319 0.23
320 0.24
321 0.25
322 0.22
323 0.22
324 0.22
325 0.2
326 0.18
327 0.23
328 0.25
329 0.23
330 0.25