Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8V6A5

Protein Details
Accession A0A1V8V6A5    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
25-52NVPKTRRTYCKGKDCKKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 10.5, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MDVSRERRKSGEATPPLTLPLHQVNVPKTRRTYCKGKDCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.44
4 0.4
5 0.32
6 0.26
7 0.24
8 0.22
9 0.22
10 0.26
11 0.29
12 0.37
13 0.4
14 0.41
15 0.41
16 0.45
17 0.5
18 0.52
19 0.57
20 0.58
21 0.65
22 0.71
23 0.76
24 0.8
25 0.8
26 0.85
27 0.84
28 0.86
29 0.85
30 0.85
31 0.83
32 0.83
33 0.86
34 0.78
35 0.76
36 0.69
37 0.64
38 0.56
39 0.5
40 0.39
41 0.31
42 0.3
43 0.29
44 0.28
45 0.25
46 0.3
47 0.34
48 0.38
49 0.42
50 0.46
51 0.42
52 0.49
53 0.56
54 0.54
55 0.56
56 0.55
57 0.55
58 0.54
59 0.58
60 0.49
61 0.45
62 0.42
63 0.35
64 0.37
65 0.39
66 0.38
67 0.33
68 0.4
69 0.44
70 0.53
71 0.62
72 0.65
73 0.64
74 0.67
75 0.74
76 0.74
77 0.73
78 0.7
79 0.66
80 0.62
81 0.62
82 0.57
83 0.52
84 0.48
85 0.42
86 0.37
87 0.35
88 0.34
89 0.36
90 0.43
91 0.46
92 0.51
93 0.6
94 0.66
95 0.7
96 0.69
97 0.63
98 0.57
99 0.52
100 0.5
101 0.5
102 0.51
103 0.52
104 0.55
105 0.52
106 0.5
107 0.49
108 0.42