Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9P1D6

Protein Details
Accession G9P1D6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MEKGEIRRWKEKKGKKEAKLAARGGRBasic
NLS Segment(s)
PositionSequence
6-29IRRWKEKKGKKEAKLAARGGRRRW
Subcellular Location(s) nucl 9plas 9, mito 5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MEKGEIRRWKEKKGKKEAKLAARGGRRRWSGLRDTEEVGESDEKSRSRVDLEMNDDETRYPECWTGPGQDMYRQSLVPPHRGHPSFPAGGAAYPAVLGTRTQAPGLVQKAYLVLACRHYMHFSIPSIQKQPPGPGPDSHQTCCSSSINHAPDCGLGAAGPLLLLLATAFARWPEIQGAPAALQWTSGCQSSLQWAATALDGTLPLLQTGNGRWHDAPTAGPQPLSQRGLHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.88
4 0.86
5 0.86
6 0.85
7 0.81
8 0.78
9 0.77
10 0.75
11 0.71
12 0.71
13 0.64
14 0.61
15 0.6
16 0.58
17 0.57
18 0.59
19 0.58
20 0.53
21 0.52
22 0.47
23 0.43
24 0.36
25 0.31
26 0.24
27 0.19
28 0.18
29 0.19
30 0.18
31 0.19
32 0.19
33 0.18
34 0.18
35 0.2
36 0.23
37 0.25
38 0.31
39 0.33
40 0.35
41 0.34
42 0.32
43 0.29
44 0.25
45 0.22
46 0.16
47 0.14
48 0.12
49 0.12
50 0.14
51 0.15
52 0.17
53 0.18
54 0.22
55 0.21
56 0.25
57 0.27
58 0.29
59 0.28
60 0.25
61 0.21
62 0.24
63 0.26
64 0.28
65 0.28
66 0.28
67 0.34
68 0.35
69 0.36
70 0.34
71 0.37
72 0.3
73 0.28
74 0.26
75 0.18
76 0.18
77 0.17
78 0.12
79 0.06
80 0.06
81 0.05
82 0.04
83 0.04
84 0.04
85 0.05
86 0.07
87 0.08
88 0.08
89 0.08
90 0.09
91 0.13
92 0.15
93 0.14
94 0.11
95 0.11
96 0.11
97 0.11
98 0.11
99 0.08
100 0.08
101 0.09
102 0.1
103 0.11
104 0.11
105 0.12
106 0.12
107 0.12
108 0.13
109 0.12
110 0.16
111 0.18
112 0.2
113 0.23
114 0.23
115 0.25
116 0.24
117 0.27
118 0.26
119 0.27
120 0.27
121 0.25
122 0.29
123 0.33
124 0.36
125 0.34
126 0.32
127 0.3
128 0.29
129 0.31
130 0.27
131 0.2
132 0.19
133 0.26
134 0.27
135 0.25
136 0.24
137 0.21
138 0.21
139 0.2
140 0.17
141 0.09
142 0.05
143 0.05
144 0.05
145 0.04
146 0.04
147 0.03
148 0.02
149 0.02
150 0.02
151 0.02
152 0.03
153 0.03
154 0.03
155 0.04
156 0.04
157 0.06
158 0.06
159 0.08
160 0.1
161 0.1
162 0.11
163 0.11
164 0.12
165 0.11
166 0.12
167 0.11
168 0.08
169 0.09
170 0.08
171 0.1
172 0.1
173 0.1
174 0.1
175 0.1
176 0.11
177 0.14
178 0.18
179 0.16
180 0.15
181 0.15
182 0.15
183 0.15
184 0.15
185 0.1
186 0.08
187 0.07
188 0.08
189 0.08
190 0.07
191 0.07
192 0.07
193 0.08
194 0.09
195 0.11
196 0.18
197 0.19
198 0.23
199 0.23
200 0.25
201 0.27
202 0.26
203 0.26
204 0.25
205 0.3
206 0.27
207 0.26
208 0.26
209 0.29
210 0.36
211 0.37