Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TWE9

Protein Details
Accession A0A1V8TWE9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-32SSQHNQAKKAHRNGIKKPKTNRYPSLHydrophilic
NLS Segment(s)
PositionSequence
13-60AKKAHRNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTQRALKEVKEG
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQAKKAHRNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTQRALKEVKEGKRDSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.78
4 0.76
5 0.76
6 0.78
7 0.81
8 0.8
9 0.79
10 0.79
11 0.8
12 0.81
13 0.81
14 0.79
15 0.77
16 0.74
17 0.7
18 0.67
19 0.61
20 0.57
21 0.52
22 0.54
23 0.5
24 0.52
25 0.56
26 0.59
27 0.64
28 0.66
29 0.72
30 0.66
31 0.71
32 0.67
33 0.68
34 0.69
35 0.66
36 0.63
37 0.58
38 0.55
39 0.49
40 0.46
41 0.37
42 0.37
43 0.38
44 0.43
45 0.46