Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8U6K9

Protein Details
Accession A0A1V8U6K9    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-90LGFSSHRQKREKKIKKEIKRGIREVDNBasic
NLS Segment(s)
PositionSequence
69-84HRQKREKKIKKEIKRG
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032672  TmcA/NAT10/Kre33  
IPR013562  TmcA_N  
Gene Ontology GO:0008080  F:N-acetyltransferase activity  
Pfam View protein in Pfam  
PF08351  TmcA_N  
Amino Acid Sequences MVKKAIDARIPALIRNGMQEKKRSFFVVVGDRQKDVIVNLYHILLNLDIKLNKSVLWAYKNKLLGFSSHRQKREKKIKKEIKRGIREVDNEDPFELF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.31
4 0.29
5 0.33
6 0.4
7 0.41
8 0.42
9 0.44
10 0.4
11 0.36
12 0.32
13 0.34
14 0.35
15 0.37
16 0.41
17 0.4
18 0.38
19 0.36
20 0.34
21 0.28
22 0.2
23 0.19
24 0.13
25 0.13
26 0.13
27 0.13
28 0.13
29 0.13
30 0.12
31 0.07
32 0.07
33 0.06
34 0.07
35 0.07
36 0.08
37 0.08
38 0.08
39 0.08
40 0.09
41 0.1
42 0.12
43 0.16
44 0.19
45 0.2
46 0.25
47 0.28
48 0.27
49 0.28
50 0.25
51 0.24
52 0.28
53 0.34
54 0.39
55 0.43
56 0.48
57 0.53
58 0.6
59 0.67
60 0.72
61 0.75
62 0.75
63 0.8
64 0.85
65 0.89
66 0.93
67 0.92
68 0.92
69 0.91
70 0.86
71 0.82
72 0.78
73 0.72
74 0.68
75 0.67
76 0.6
77 0.52