Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8UDU4

Protein Details
Accession A0A1V8UDU4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-84EGPKAGKGKKRKAQKMDDDNEBasic
NLS Segment(s)
PositionSequence
65-76GPKAGKGKKRKA
Subcellular Location(s) mito 17, cyto_mito 13.5, cyto 8
Family & Domain DBs
Amino Acid Sequences MAPKPTTTLTPHQVLQLTYVCRAMTKGPDIDYEVFGQLGGYSSAFNARKSFHALMRAVMARGDEGPKAGKGKKRKAQKMDDDNEGEQGEEGATVAKKQKGVSAEKGGMGEIVQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.3
4 0.26
5 0.23
6 0.24
7 0.2
8 0.18
9 0.19
10 0.18
11 0.18
12 0.2
13 0.21
14 0.2
15 0.22
16 0.25
17 0.26
18 0.24
19 0.21
20 0.18
21 0.15
22 0.14
23 0.12
24 0.08
25 0.07
26 0.06
27 0.05
28 0.04
29 0.05
30 0.11
31 0.12
32 0.13
33 0.13
34 0.14
35 0.16
36 0.22
37 0.24
38 0.19
39 0.24
40 0.23
41 0.23
42 0.24
43 0.23
44 0.17
45 0.15
46 0.13
47 0.08
48 0.09
49 0.09
50 0.06
51 0.07
52 0.08
53 0.09
54 0.12
55 0.16
56 0.21
57 0.3
58 0.4
59 0.46
60 0.56
61 0.64
62 0.7
63 0.76
64 0.8
65 0.82
66 0.76
67 0.75
68 0.69
69 0.6
70 0.53
71 0.43
72 0.33
73 0.22
74 0.18
75 0.11
76 0.07
77 0.06
78 0.06
79 0.06
80 0.08
81 0.13
82 0.15
83 0.18
84 0.18
85 0.22
86 0.27
87 0.33
88 0.39
89 0.42
90 0.42
91 0.42
92 0.42
93 0.37
94 0.31