Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8U0L6

Protein Details
Accession A0A1V8U0L6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
128-148ASSDRPSKPRSDKPRKPKAVIHydrophilic
NLS Segment(s)
PositionSequence
134-145SKPRSDKPRKPK
Subcellular Location(s) mito 13.5, mito_nucl 13.166, nucl 11.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
Amino Acid Sequences MRIRLRGHLYSSPHKDHHLGTASVLSRPSTGLKFKDKKPSGESNGDTEKGETGLHRGYRDRSPRKDSYRTRTPPPAEPPSKSGAPTTVLDDASQTQPASNPSMSTNDKFRNYKPPKNPILHHEPTTTASSDRPSKPRSDKPRKPKAVIPTGPMIVVNVNDRLGTKAAIPCLASDSVKAFKAVVAAHIGRQPHEIMIKRQGERPFKDALTLEDYGVSSGVQLDLEIETGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.47
4 0.48
5 0.44
6 0.36
7 0.31
8 0.35
9 0.32
10 0.31
11 0.3
12 0.23
13 0.18
14 0.19
15 0.21
16 0.19
17 0.24
18 0.28
19 0.37
20 0.44
21 0.5
22 0.6
23 0.61
24 0.63
25 0.64
26 0.69
27 0.65
28 0.66
29 0.62
30 0.57
31 0.57
32 0.52
33 0.45
34 0.36
35 0.29
36 0.21
37 0.2
38 0.14
39 0.12
40 0.16
41 0.18
42 0.19
43 0.21
44 0.24
45 0.32
46 0.43
47 0.48
48 0.51
49 0.57
50 0.64
51 0.69
52 0.76
53 0.76
54 0.75
55 0.76
56 0.74
57 0.72
58 0.73
59 0.68
60 0.66
61 0.65
62 0.66
63 0.59
64 0.56
65 0.53
66 0.48
67 0.46
68 0.39
69 0.32
70 0.24
71 0.22
72 0.21
73 0.2
74 0.17
75 0.16
76 0.15
77 0.15
78 0.15
79 0.13
80 0.14
81 0.11
82 0.08
83 0.09
84 0.11
85 0.13
86 0.11
87 0.11
88 0.11
89 0.16
90 0.18
91 0.19
92 0.23
93 0.24
94 0.29
95 0.3
96 0.31
97 0.38
98 0.43
99 0.51
100 0.53
101 0.58
102 0.6
103 0.63
104 0.63
105 0.57
106 0.59
107 0.54
108 0.48
109 0.4
110 0.34
111 0.31
112 0.31
113 0.26
114 0.17
115 0.15
116 0.16
117 0.21
118 0.24
119 0.27
120 0.27
121 0.34
122 0.41
123 0.5
124 0.58
125 0.63
126 0.69
127 0.74
128 0.83
129 0.83
130 0.8
131 0.76
132 0.74
133 0.73
134 0.66
135 0.59
136 0.51
137 0.44
138 0.4
139 0.34
140 0.25
141 0.15
142 0.13
143 0.11
144 0.09
145 0.09
146 0.09
147 0.09
148 0.11
149 0.11
150 0.1
151 0.11
152 0.13
153 0.14
154 0.15
155 0.15
156 0.13
157 0.15
158 0.16
159 0.14
160 0.12
161 0.15
162 0.16
163 0.16
164 0.17
165 0.14
166 0.13
167 0.15
168 0.14
169 0.13
170 0.15
171 0.15
172 0.17
173 0.2
174 0.2
175 0.18
176 0.2
177 0.19
178 0.17
179 0.23
180 0.24
181 0.26
182 0.35
183 0.41
184 0.41
185 0.47
186 0.53
187 0.56
188 0.56
189 0.55
190 0.51
191 0.44
192 0.47
193 0.41
194 0.37
195 0.34
196 0.3
197 0.27
198 0.23
199 0.23
200 0.19
201 0.18
202 0.14
203 0.08
204 0.08
205 0.08
206 0.06
207 0.06
208 0.06
209 0.06